{"uniprot":"Q8WVF5","gene":"KCTD4","name":"BTB/POZ domain-containing protein KCTD4","organism":"Homo sapiens (Human)","status":"dark","length":259,"sequence":"MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIQFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK","function_summary":"A soluble cytosolic adaptor that uses an N-terminal oligomerizing scaffold to assemble inhibitory complexes on delayed rectifier potassium channels. By forming multivalent assemblies through its BTB core and a KCTD4-specific C-terminal region, it binds channel cytosolic tails and recruits phosphodiesterases to locally modulate cyclic nucleotide signaling. This coordinated binding and scaffolding suppresses channel activity from the cytoplasmic side of the membrane.","plain_language":"KCTD4 has barely been studied. The model's best guess: A soluble cytosolic adaptor that uses an N-terminal oligomerizing scaffold to assemble inhibitory complexes on delayed rectifier potassium channels. By forming multivalent assemblies through its BTB core and a KCTD4-specific C-terminal region, it binds channel cytosolic tails and recruits phosphodiesterases to locally modulate cyclic nucleotide signaling.","uniprot_summary":"May act as a soluble adapter protein. May negatively regulate delayed rectifier potassium channels. May function through complex formation with phosphodiesterases.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:1902260","label":"negative regulation of delayed rectifier potassium channel activity"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"}]},"interpro":[{"id":"IPR011333","name":"SKP1/BTB/POZ domain superfamily","type":"homologous_superfamily","start":27,"end":135},{"id":"IPR000210","name":"BTB/POZ domain","type":"domain","start":33,"end":134},{"id":"IPR003131","name":"Potassium channel tetramerisation-type BTB domain","type":"domain","start":36,"end":122},{"id":"IPR045740","name":"BTB/POZ domain-containing protein KCTD4, C-terminal","type":"domain","start":138,"end":259}],"reasoning":"I begin with the InterPro architecture. The N-terminal half is dominated by a BTB/POZ scaffold: IPR011333 (SKP1/BTB/POZ domain superfamily, residues 27–135) encompasses a canonical BTB core that is explicitly annotated by IPR000210 (BTB/POZ domain, residues 33–134). Within this core sits IPR003131 (Potassium channel tetramerisation-type BTB domain, residues 36–122), a hallmark that BTB folds in this subfamily are adapted to oligomerize and to engage cytosolic channel tails. This triad establishes an oligomerizing protein–protein interaction module that nucleates higher-order assemblies and recruits partners through avid multivalent binding. The C-terminal half is a lineage-specific tail, IPR045740 (BTB/POZ domain-containing protein KCTD4, C-terminal, residues 138–259), which typically confers target selectivity and regulatory control distinct from the BTB core. The ordered layout—an N-terminal BTB/POZ oligomerization hub followed by a KCTD4-specific C-terminal determinant—creates a soluble adaptor optimized for assembling and modulating cytosolic complexes.\n\nThis BTB-centered architecture dictates molecular function as protein binding (GO:0005515). The BTB/POZ fold forms obligate dimers or tetramers and presents composite surfaces that capture cytosolic regions of membrane proteins and signaling enzymes. The potassium channel tetramerisation-type signature (IPR003131) further indicates that the BTB array is tuned to engage and regulate channel assemblies, consistent with a role as a cytosolic adaptor rather than a pore-forming unit.\n\nFrom this binding capacity, the biological process emerges. A BTB-driven adaptor that recognizes channel cytosolic tails can down-modulate delayed rectifier potassium channels by two convergent mechanisms: first, by sequestering or altering channel tetramers through the potassium-channel-tetramerisation-type interface; second, by recruiting phosphodiesterases via the KCTD4-specific C-terminus to locally reduce cyclic nucleotide levels that influence channel gating. These causal routes align with negative regulation of delayed rectifier potassium channel activity (GO:1902260).\n\nCellular location follows from the soluble, oligomerizing architecture and the absence of transmembrane segments: the protein operates in the cytosol (GO:0005829). A cytosolic adaptor can approach the inner face of the plasma membrane from the cytoplasmic side, where it assembles inhibitory complexes proximal to channel macromolecular assemblies.\n\nMechanistically, I hypothesize that the BTB core oligomerizes to form a multivalent platform that binds delayed rectifier channel subunits and simultaneously recruits cyclic nucleotide–sensing phosphodiesterases. The KCTD4-specific C-terminus likely provides docking specificity for these enzymes, thereby coupling channel complexes to local second-messenger turnover. Through this assembly, the adaptor dampens channel activity by stabilizing inhibitory conformations and/or reducing cAMP/cGMP-dependent modulation. Likely interaction partners include delayed rectifier potassium channel cytosolic tails and phosphodiesterases that tune the local signaling milieu.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8WVF5.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8WVF5"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8WVF5/entry","atlas":"/p/Q8WVF5"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}