{"uniprot":"Q8WWB7","gene":"GLMP","name":"Glycosylated lysosomal membrane protein","organism":"Homo sapiens (Human)","status":"dark","length":406,"sequence":"MRGSVECTWGWGHCAPSPLLLWTLLLFAAPFGLLGEKTRQVSLEVIPNWLGPLQNLLHIRAVGTNSTLHYVWSSLGPLAVVMVATNTPHSTLSVNWSLLLSPEPDGGLMVLPKDSIQFSSALVFTRLLEFDSTNVSDTAAKPLGRPYPPYSLADFSWNNITDSLDPATLSATFQGHPMNDPTRTFANGSLAFRVQAFSRSSRPAQPPRLLHTADTCQLEVALIGASPRGNRSLFGLEVATLGQGPDCPSMQEQHSIDDEYAPAVFQLDQLLWGSLPSGFAQWRPVAYSQKPGGRESALPCQASPLHPALAYSLPQSPIVRAFFGSQNNFCAFNLTFGASTGPGYWDQHYLSWSMLLGVGFPPVDGLSPLVLGIMAVALGAPGLMLLGGGLVLLLHHKKYSEYQSIN","function_summary":"A human multi-pass membrane scaffold that resides predominantly on lysosomal membranes and uses multivalent protein binding to organize trafficking and signaling assemblies that maintain lysosome function and biogenesis. By recruiting cytosolic adaptors and small GTPases at the endolysosomal surface, it stabilizes lysosomal homeostasis and relays signals that enhance RNA polymerase II–dependent transcription. Dynamic pools in the cytosol and occasional nuclear accumulation reflect its role in coupling lysosomal status to transcriptional outputs.","plain_language":"GLMP has barely been studied. The model's best guess: A human multi-pass membrane scaffold that resides predominantly on lysosomal membranes and uses multivalent protein binding to organize trafficking and signaling assemblies that maintain lysosome function and biogenesis. By recruiting cytosolic adaptors and small GTPases at the endolysosomal surface, it stabilizes lysosomal homeostasis and relays signals that enhance RNA polymerase II–dependent transcription.","uniprot_summary":"May play a role in lysosome biogenesis or function.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0045944","label":"positive regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005764","label":"lysosome"},{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005634","label":"nucleus"}]},"interpro":[{"id":"IPR029382","name":"Glycosylated lysosomal membrane protein","type":"family","start":13,"end":406}],"reasoning":"I begin with the InterPro architecture: IPR029382 (Glycosylated lysosomal membrane protein family) spans residues 13–406, essentially covering the entire polypeptide. A single, family-defining signature that occupies nearly the full length indicates a specialized, non-enzymatic membrane protein whose function is encoded by overall architecture rather than discrete catalytic motifs. Members of this family are multi-pass membrane proteins that acquire extensive lysosomal glycosylation and typically localize to endolysosomal membranes. Such an architecture predisposes the protein to act as a membrane-embedded scaffold or adaptor that binds other proteins and organizes trafficking and signaling modules.\n\nThis family-level architecture causally supports a molecular function centered on multivalent protein binding (GO:0005515). Multi-pass lysosomal membrane scaffolds commonly present cytosolic loops that recruit cytosolic factors and lumenal loops that engage lysosomal cargo; together this creates a platform for selective protein–protein interactions rather than enzymatic chemistry.\n\nFrom this binding-centric membrane scaffold, two biological roles emerge. First, the membrane-anchored platform can influence transcription indirectly by signaling pathways emanating from endolysosomal compartments. Endolysosome-to-nucleus communication frequently modulates RNA polymerase II–dependent transcription; thus, a membrane scaffold that nucleates signaling and chromatin-modifying assemblies provides a mechanistic route to positive regulation of transcription by RNA polymerase II (GO:0045944). Second, the same scaffold can tune lysosome biogenesis and function—consistent with a role in lysosomal homeostasis—by recruiting trafficking and maturation machinery.\n\nThe cellular context follows from the architecture and trafficking itinerary. The IPR029382 family dictates a lysosomal membrane residency, aligning with a primary localization to the lysosome (GO:0005764). The presence of cytosolic loops and documented shuttling rationalize detection in the cytosol (GO:0005829), where transient pools of the protein and its binding partners assemble. Nuclear accumulation (GO:0005634) is explained by signaling-dependent translocation of bound factors and occasional nuclear import of the cytosolic pool, enabling transcriptional modulation.\n\nMechanistically, I hypothesize that the protein forms a multi-pass lysosomal membrane hub that binds cytosolic trafficking adaptors and small GTPases to regulate endolysosome dynamics, while also coupling to nuclear signaling pathways that enhance RNA polymerase II–driven transcription. Likely interaction partners include lysosomal membrane glycoproteins and trafficking modules (e.g., LAMP family, AP-3 adaptor complex, RAB7/RAB9 GTPases), which together coordinate lysosome biogenesis and positioning. Through these assemblies, the protein can both stabilize lysosomal function and relay signals that elevate transcriptional programs downstream of lysosomal status.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8WWB7.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8WWB7"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8WWB7/entry","atlas":"/p/Q8WWB7"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}