{"uniprot":"Q8WWF3","gene":"SSMEM1","name":"Serine-rich single-pass membrane protein 1","organism":"Homo sapiens (Human)","status":"dark","length":244,"sequence":"MGDLFSLFWEVDPPPIPVNCAIPNQDYECWKDDSCGTIGSFLLWYFVIVFVLMFFSRASVWMSEDKKDEGSGTSTSVRKASKETSCKRQSKDSAWDPSQTMKKPKQNQLTPVTNSEVALVNAYPEQRRARRQSQFNEVNQNQHDSDTTEYGSEESNSEASSWKESESEHHPSPDSIKRRKMAQRQRNLGSYQMSERHCLHCKALRTNEWLAHHSRQKPSVTPPMKRDSQEESSISDINKKFSKF","function_summary":"A membrane-anchored adaptor that resides on endoplasmic reticulum and Golgi membranes and uses a cytosolic-facing tail to assemble trafficking and proteostasis complexes. By scaffolding vesicle formation and cargo sorting at the ER–Golgi interface, it promotes vesicle-mediated transport while biasing protein quality control toward membrane-associated pathways and away from cytosolic proteasomal turnover. Its single-pass type II topology stabilizes residence at internal membranes and coordinates transport with localized degradation to maintain cellular homeostasis.","plain_language":"SSMEM1 has barely been studied. The model's best guess: A membrane-anchored adaptor that resides on endoplasmic reticulum and Golgi membranes and uses a cytosolic-facing tail to assemble trafficking and proteostasis complexes. By scaffolding vesicle formation and cargo sorting at the ER–Golgi interface, it promotes vesicle-mediated transport while biasing protein quality control toward membrane-associated pathways and away from cytosolic proteasomal turnover.","uniprot_summary":"May be involved in vesicular pathway.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0016192","label":"vesicle-mediated transport"},{"id":"GO:1901799","label":"negative regulation of proteasomal protein catabolic process"}],"cellular_component":[{"id":"GO:0005789","label":"endoplasmic reticulum membrane"}]},"interpro":[{"id":"IPR027955","name":"Protein of unknown function DUF4636","type":"family","start":1,"end":244}],"reasoning":"I begin with the InterPro architecture: IPR027955 (Protein of unknown function DUF4636 family) spans residues 1–244, covering essentially the entire polypeptide. A single full-length DUF family signature without catalytic motifs or soluble enzymatic domains typically encodes a membrane-tethered scaffold/adaptor rather than an enzyme. The annotation as a single-pass type II membrane protein places an N-terminal cytosolic tail followed by one transmembrane helix and a luminal C-terminus. This topology is well-suited for assembling protein complexes on the cytosolic face of internal membranes and for coupling membrane trafficking to cytosolic pathways.\n\nThis architecture causally supports a binding-centric molecular function. The absence of catalytic cores and the presence of a membrane-anchored scaffold strongly favor GO:0005515 protein binding as the primary molecular function. A cytosolic N-terminus on the endoplasmic reticulum (ER) and Golgi membranes can recruit cytosolic effectors that regulate vesicle budding, cargo selection, and proteostasis.\n\nFrom this binding-centric platform, the biological processes follow. Vesicle-mediated transport (GO:0016192) is driven by a membrane anchor that positions cytosolic adaptors and coats at ER and Golgi interfaces. By stabilizing trafficking assemblies and modulating cargo flux, the protein directly contributes to vesicular pathways. In parallel, negative regulation of proteasomal protein catabolic process (GO:1901799) emerges mechanistically from ER/Golgi-tethered scaffolding that biases proteostasis toward ER-associated degradation (ERAD) and away from cytosolic proteasomal pathways—for example, by sequestering misfolded clients and routing them through membrane-associated quality control rather than free cytosolic degradation. Thus, the same binding platform that organizes transport can attenuate proteasome-driven turnover by coordinating membrane-proximal quality control.\n\nCellular localization is dictated by the topology and trafficking itinerary. The single-pass type II configuration and the experimentally supported itinerary place the protein at the endoplasmic reticulum membrane (GO:0005789) and Golgi apparatus membrane. The ER residency provides a staging ground for ERAD and secretory pathway initiation, while Golgi localization situates it at a central sorting hub. The membrane anchor ensures stable residency at these organelles, and the cytosolic tail enables dynamic interactions with trafficking machinery.\n\nPutting these elements together, I hypothesize a mechanism in which the DUF4636 scaffold nucleates protein assemblies on ER and Golgi membranes to tune vesicle formation and cargo flow while dampening proteasome engagement. Likely partners include COPII/COPI coat components and adaptors that drive vesicle-mediated transport, as well as ER quality-control factors that handle misfolded luminal and membrane proteins. By concentrating these modules at the ER–Golgi interface, the protein can couple secretory trafficking with membrane-proximal proteostasis, thereby reducing unnecessary proteasomal activity and maintaining protein homeostasis.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8WWF3.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8WWF3"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8WWF3/entry","atlas":"/p/Q8WWF3"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}