{"uniprot":"Q8WWF6","gene":"DNAJB3","name":"DnaJ homolog subfamily B member 3","organism":"Homo sapiens (Human)","status":"dark","length":145,"sequence":"MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGEAGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLENILGGSEELLGKQKQSVCTPFLCLQ","function_summary":"A soluble human co-chaperone that uses a J-domain to bind and activate Hsp70, thereby stimulating ATPase-driven cycles that capture and release non-native proteins. It operates within the broader proteostasis network that responds to unfolded protein stress and is predominantly enriched in the nucleus, where it likely stabilizes and repairs nuclear protein assemblies. By accelerating Hsp70’s hydrolysis cycle through its conserved catalytic motif, it coordinates client refolding and prevents aggregation in nucleocytoplasmic compartments.","plain_language":"DNAJB3 has barely been studied. The model's best guess: A soluble human co-chaperone that uses a J-domain to bind and activate Hsp70, thereby stimulating ATPase-driven cycles that capture and release non-native proteins. It operates within the broader proteostasis network that responds to unfolded protein stress and is predominantly enriched in the nucleus, where it likely stabilizes and repairs nuclear protein assemblies.","uniprot_summary":"May function as a chaperone.","go_terms":{"molecular_function":[{"id":"GO:0030544","label":"Hsp70 protein binding"}],"biological_process":[{"id":"GO:0006986","label":"response to unfolded protein"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR036869","name":"Chaperone J-domain superfamily","type":"homologous_superfamily","start":1,"end":113},{"id":"IPR001623","name":"DnaJ domain","type":"domain","start":2,"end":80},{"id":"IPR043183","name":"DnaJ homolog subfamily B member 2/6-like","type":"family","start":1,"end":122},{"id":"IPR018253","name":"DnaJ domain, conserved site","type":"conserved_site","start":46,"end":65}],"reasoning":"I begin with the InterPro architecture. The polypeptide is dominated by a canonical J-domain module: IPR001623 (DnaJ domain, residues 2–80) sits at the N-terminus and is encompassed by IPR036869 (Chaperone J-domain superfamily, residues 1–113), indicating a classical Hsp70 co-chaperone scaffold. The J-domain’s catalytic core is reinforced by IPR018253 (DnaJ domain, conserved site, residues 46–65), which marks the invariant HPD motif that stimulates Hsp70 ATP hydrolysis. The overall family assignment IPR043183 (DnaJ homolog subfamily B member 2/6-like, residues 1–122) specifies a type II J-protein architecture that lacks the glycine/phenylalanine-rich region and transmembrane segments, favoring soluble, nucleocytoplasmic behavior. The ordered layout—an N-terminal J-domain with a conserved HPD site embedded in a soluble J-protein framework—causally defines a co-chaperone that binds and activates Hsp70.\n\nThis J-domain architecture dictates the molecular function. The HPD-centered J-domain binds Hsp70 and accelerates its ATPase cycle; thus the primary activity is Hsp70 engagement formalized as GO:0030544 Hsp70 protein binding. By stimulating Hsp70’s ATP hydrolysis and client capture/release, the protein drives conformational cycles that resolve misfolded states.\n\nFrom this molecular function, the biological process follows. J-protein–Hsp70 pairs are central to proteostasis pathways that respond to proteotoxic stress. By accelerating Hsp70-dependent folding and preventing aggregation, the protein operates within the cellular program that senses and resolves unfolded proteins, aligning with GO:0006986 response to unfolded protein.\n\nThe cellular context is inferred from the soluble architecture and stress-responsive roles. The absence of transmembrane features and the J-protein subfamily B signature support a nucleocytoplasmic distribution. Stress-responsive chaperone systems frequently concentrate in the nucleus to safeguard chromatin-associated assemblies and RNA processing hubs; this supports localization to GO:0005654 nucleoplasm and is consistent with predominant nuclear enrichment under proteostasis pressure.\n\nMechanistically, the J-domain binds Hsp70, triggers ATP hydrolysis via the HPD motif, and thereby stabilizes client-bound Hsp70 until nucleotide exchange releases substrates. In the nucleus, this cycle likely safeguards transcription and RNA maturation complexes. I hypothesize that the protein forms transient assemblies with cytosolic/nuclear Hsp70s and nucleotide-exchange factors to triage misfolded clients. Likely partners include constitutive and inducible Hsp70s that operate in both cytoplasm and nucleus, as well as adaptor networks that route clients toward refolding or degradation pathways. Together, these assemblies create a nuclear-centered proteostasis node that buffers unfolded protein stress and maintains essential nuclear machineries.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8WWF6.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8WWF6"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8WWF6/entry","atlas":"/p/Q8WWF6"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}