{"uniprot":"Q8WZ33","gene":"MAFIP","name":"MaFF-interacting protein","organism":"Homo sapiens (Human)","status":"dark","length":124,"sequence":"MLCPRAAFLVGSFHGVFPGPPASSHWEFWVPSTPVGAYFCPPQPQLTPPNTPKLVSEVEELYKSITALREKLLQAEQSLRNLKDIHMSLEKDVTAMTNSVFIDRQKCMAHRTCYPTILQLAGYQ","function_summary":"A human tektin-like scaffold that assembles higher-order protein complexes during spermatogenesis. By using a filament-forming core to bind partners, it organizes nuclear assemblies that coordinate germ-cell quality control and promote apoptotic execution pathways. Its activity centers on multivalent protein interactions that stabilize regulatory platforms, thereby facilitating caspase activation within the nucleus during spermatogenic checkpoints.","plain_language":"MAFIP has barely been studied. The model's best guess: A human tektin-like scaffold that assembles higher-order protein complexes during spermatogenesis. By using a filament-forming core to bind partners, it organizes nuclear assemblies that coordinate germ-cell quality control and promote apoptotic execution pathways.","uniprot_summary":"May be involved in spermatogenesis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0006919","label":"activation of cysteine-type endopeptidase activity involved in apoptotic process"}],"cellular_component":[{"id":"GO:0005634","label":"nucleus"}]},"interpro":[{"id":"IPR000435","name":"Tektins","type":"family","start":53,"end":123},{"id":"IPR048256","name":"Tektin-like","type":"family","start":53,"end":115}],"reasoning":"I begin with the InterPro architecture. Two overlapping family signatures define the core of the polypeptide: IPR000435 (Tektin-like family, residues 53–123) and IPR048256 (Tektin-like family, residues 53–115). This tandem assignment to the tektin superfamily marks a coiled-coil–rich, non-enzymatic scaffold class that polymerizes into filamentous assemblies and binds other cytoskeletal elements. The restricted span of these domains concentrated in the central region implies that the N- and C-termini contribute auxiliary interaction surfaces rather than catalytic motifs. The absence of catalytic domains and the presence of a filament-forming family signature causally enforce a molecular role dominated by multivalent protein binding, aligning with GO:0005515 protein binding.\n\nTektin-like scaffolds typically stabilize higher-order cytoskeletal structures and couple them to regulatory modules. In germ cells, such scaffolds can nucleate or reinforce assemblies that coordinate chromosome dynamics and cytoskeletal forces. A scaffold that organizes complexes around chromatin and cytoskeleton can influence apoptotic checkpoints during spermatogenesis. By assembling or exposing pro-apoptotic platforms, a tektin-like framework can facilitate the cascade that culminates in caspase activation. This mechanistic linkage supports the biological process formalized as GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process.\n\nCellular placement follows from this architecture and function. Tektin-like assemblies are classically cytoskeletal, yet many germ-cell scaffolds shuttle between cytoplasm and nucleus to coordinate chromatin state and apoptosis. The explicit evidence here points to a nuclear residence (GO:0005634 nucleus), which is consistent with a role in spermatogenic checkpoints where nuclear assemblies govern DNA-associated transitions and trigger caspase pathways. A nuclear-localized tektin-like scaffold can anchor or signal to nuclear pores and chromatin-bound complexes, thereby priming caspase activation during quality-control phases of germ-cell maturation.\n\nIntegrating these lines, I infer a mechanism in which a tektin-like scaffold organizes nuclear complexes that sense or impose spermatogenic quality control, then promote caspase activation to eliminate defective germ cells. Likely partners include cytoskeletal and spindle-associated proteins that interface with nuclear events, as well as nuclear transport and apoptotic regulators. I hypothesize transient assemblies with tektin family members and axonemal/spindle-associated adaptors to form a structural hub; with nuclear pore and chromatin regulators to gate access to apoptotic signaling; and with caspase-activating modules that execute the apoptotic program during spermatogenesis.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8WZ33.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8WZ33"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8WZ33/entry","atlas":"/p/Q8WZ33"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}