{"uniprot":"Q8WZA8","gene":"GCRG224","name":"Putative gastric cancer-related gene 224 protein","organism":"Homo sapiens (Human)","status":"dark","length":35,"sequence":"MIPGNPSPGADLAVSKHFFSLSWFCGLLLLESKQK","function_summary":"A non-enzymatic adaptor that uses multivalent protein binding to organize mitochondrial function and suppress assembly of proinflammatory and amyloidogenic complexes. By stabilizing mitochondrial integrity and restraining inflammasome and fibril-forming pathways, it dampens cytokine production and neuronal apoptosis. The scaffold coordinates chemotactic signaling and leukocyte trafficking in stromal and immune contexts and operates across cytoplasm, perinuclear and mitochondrial compartments, with additional pools in the nucleus and extracellular milieu and enrichment at the sperm midpiece where mitochondrial energy supply is critical.","plain_language":"GCRG224 has barely been studied. The model's best guess: A non-enzymatic adaptor that uses multivalent protein binding to organize mitochondrial function and suppress assembly of proinflammatory and amyloidogenic complexes. By stabilizing mitochondrial integrity and restraining inflammasome and fibril-forming pathways, it dampens cytokine production and neuronal apoptosis.","uniprot_summary":"May be involved in inflammatory response and regulation of neuronal apoptosis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0030595","label":"leukocyte chemotaxis"},{"id":"GO:1902883","label":"negative regulation of response to oxidative stress"},{"id":"GO:0050728","label":"negative regulation of inflammatory response"},{"id":"GO:0032652","label":"regulation of interleukin-1 production"},{"id":"GO:0032692","label":"negative regulation of interleukin-1 production"},{"id":"GO:0007005","label":"mitochondrion organization"},{"id":"GO:1900226","label":"negative regulation of NLRP3 inflammasome complex assembly"},{"id":"GO:1905906","label":"regulation of amyloid fibril formation"},{"id":"GO:0043524","label":"negative regulation of neuron apoptotic process"}],"cellular_component":[{"id":"GO:0005615","label":"extracellular space"},{"id":"GO:0097225","label":"sperm midpiece"},{"id":"GO:0048471","label":"perinuclear region of cytoplasm"},{"id":"GO:0005739","label":"mitochondrion"},{"id":"GO:0005634","label":"nucleus"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding. The absence of catalytic InterPro signatures and the prominence of a generic protein-binding label indicate a non-enzymatic scaffold/adaptor whose primary chemistry is mediated through selective protein–protein interactions. Such an adaptor architecture causally supports broad binding capacity and explains how the protein can assemble or inhibit supramolecular assemblies and signaling complexes.\n\nFrom this binding-centric core, I infer molecular function and process. A binding scaffold that tunes inflammatory and neuronal pathways naturally explains several coupled biological processes. By organizing cytosolic and organellar assemblies, it can suppress assembly of large innate immune complexes and stress assemblies, which maps to negative regulation of NLRP3 inflammasome complex assembly (GO:1900226) and negative regulation of amyloid fibril formation (GO:1905906). Its inhibitory influence on cytokine maturation and secretion aligns with negative regulation of interleukin-1 production (GO:0032692) and negative regulation of neuron apoptotic process (GO:0043524). The same binding-driven control over organelle dynamics accounts for mitochondrion organization (GO:0007005), a prerequisite for both energy supply and apoptotic thresholds. In immune and stromal contexts, this scaffolded control of chemokine and adhesion modules supports leukocyte chemotaxis (GO:0030595) and broader cell movement programs.\n\nCellular localization follows from the same architecture and processes. The protein’s soluble adaptor nature and its role in mitochondrial and perinuclear assemblies place it in the cytoplasm and perinuclear region of cytoplasm (GO:0048471). Mitochondrial organization and energy coupling justify a mitochondrial residence (GO:0005739). Transcriptional and chromatin-proximal regulation during stress responses rationalizes a nucleus presence (GO:0005634). Its involvement in extracellular matrix and inflammatory milieus, together with reports of secreted or vesicle-associated pools, supports an extracellular space localization (GO:0005615). In specialized cells, its association with energy-dense organelles explains enrichment at the sperm midpiece (GO:0097225), where mitochondrial sheaths power flagellar beating.\n\nMechanistically, a coherent model emerges: a non-enzymatic binding scaffold that tunes mitochondrial integrity and innate immune assemblies. By stabilizing mitochondrial function and restraining inflammasome and amyloidogenic pathways, it lowers apoptotic signaling and curbs excessive cytokine production. In stromal and immune niches, this scaffolding modulates chemotactic cues and leukocyte trafficking. I hypothesize that the protein forms transient complexes with mitochondrial outer-membrane and cytosolic factors (e.g., TOMM20/TOMM22 and VDAC1) to sense and buffer mitochondrial stress; with inflammasome components (NLRP3, PYCARD/ASC, CASP1) to inhibit assembly; and with amyloidogenic machinery (APP processing modules and chaperones) to suppress fibrillogenesis. In neurons and glia, it likely interfaces with TXNIP/NF-kappa-B pathways and cytoskeletal adaptors to coordinate survival and chemotaxis. This adaptor logic causally links its binding-centric domain architecture to the observed suite of cellular processes and localizations.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8WZA8.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8WZA8"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8WZA8/entry","atlas":"/p/Q8WZA8"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}