{"uniprot":"Q969H9","gene":"DIRC1","name":"Disrupted in renal carcinoma protein 1","organism":"Homo sapiens (Human)","status":"dark","length":104,"sequence":"MPEAHMQPAKLQTSLPTTDHGSKKPVSCYLPPLSNAHPMCIEVQNAQNCSSAAATLEPSIISDTCFYKPITKDQLSSRSELNTVRLKCLNSLRGWKILNQLSLT","function_summary":"A soluble adaptor that organizes protein assemblies to optimize energy production. Its architecture indicates a non-enzymatic scaffold that binds other proteins and tunes oxidative phosphorylation by stabilizing or coordinating assemblies that generate ATP from a proton gradient. The most parsimonious location for this activity is the mitochondrion, where coupling between respiratory complexes and ATP synthase is dynamically regulated through multivalent protein interactions.","plain_language":"DIRC1 has barely been studied. The model's best guess: A soluble adaptor that organizes protein assemblies to optimize energy production. Its architecture indicates a non-enzymatic scaffold that binds other proteins and tunes oxidative phosphorylation by stabilizing or coordinating assemblies that generate ATP from a proton gradient.","uniprot_summary":"May be involved in energy production.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0015986","label":"proton motive force-driven ATP synthesis"}],"cellular_component":[{"id":"GO:0005739","label":"mitochondrion"}]},"interpro":[{"id":"IPR059079","name":"Disrupted in renal carcinoma protein 1","type":"family","start":1,"end":93}],"reasoning":"I begin with the InterPro architecture: IPR059079 (Disrupted in renal carcinoma protein 1 family) spans residues 1–93, covering essentially the entire polypeptide. A single, compact family signature without catalytic subdomains or transmembrane motifs indicates a soluble adaptor/scaffold rather than an enzyme or transporter. Such architectures typically mediate multivalent contacts that organize other proteins into functional assemblies, which causally supports a binding-centric molecular role consistent with GO:0005515 protein binding.\n\nA binding-driven scaffold in a low-complexity family points toward assembly and regulation of larger machines. The biological label GO:0015986 proton motive force-driven ATP synthesis maps most naturally to oxidative phosphorylation, where ATP synthase uses a transmembrane proton gradient generated by the respiratory chain. A soluble adaptor that resides near mitochondria can stabilize or regulate the coupling between proton pumping and ATP synthesis, or coordinate assembly and maintenance of the ATP synthase–respiratory supercomplex. The absence of enzymatic motifs and the presence of a full-length family signature together argue that this protein exerts control through protein–protein interactions that tune energy-transduction efficiency rather than catalyzing steps directly.\n\nCellular localization follows from this energy-transduction logic. GO:0005739 mitochondrion is the most parsimonious compartmental assignment because chemiosmotic ATP production occurs there. A soluble, matrix- or inner-membrane-proximal adaptor can bridge components of the ATP synthase and associated complexes. The soluble nature inferred from the single family domain and lack of transmembrane elements further supports a mitochondrial, non-membrane-embedded role that coordinates nearby assemblies.\n\nMechanistically, I hypothesize that the protein forms a mitochondrial adaptor hub that binds multiple partners to optimize proton motive force utilization. By concentrating interaction surfaces typical of the DISC1-family scaffold, it likely recruits and stabilizes elements of the ATP synthase and respiratory chain, thereby tuning ATP output. This adaptor role explains the molecular function (protein binding), the process (ATP synthesis driven by a proton gradient), and the cellular component (mitochondrion). From this model, probable partners include ATP synthase subunits and assembly factors, as well as mitochondrial organizing proteins that govern cristae architecture and bioenergetic coupling.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q969H9.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q969H9"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q969H9/entry","atlas":"/p/Q969H9"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}