{"uniprot":"Q96E35","gene":"ZMYND19","name":"Zinc finger MYND domain-containing protein 19","organism":"Homo sapiens (Human)","status":"dark","length":227,"sequence":"MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPER","function_summary":"A cytoplasmic, synapse-enriched RNA–protein assembly factor that couples an N-terminal nuclease-like module to a C-terminal MYND interaction hub. The N-terminal module binds and positions RNA for endonucleolytic events, while the MYND zinc finger recruits partner proteins to build ribonucleoprotein assemblies. Together these features enable RNA cleavage and remodeling in neuronal cytoplasm and at synaptic sites, where transient membrane-proximal anchoring likely occurs through adaptor-mediated interactions.","plain_language":"ZMYND19 has barely been studied. The model's best guess: A cytoplasmic, synapse-enriched RNA–protein assembly factor that couples an N-terminal nuclease-like module to a C-terminal MYND interaction hub. The N-terminal module binds and positions RNA for endonucleolytic events, while the MYND zinc finger recruits partner proteins to build ribonucleoprotein assemblies.","uniprot_summary":"May be involved in RNA cleavage.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0090502","label":"RNA phosphodiester bond hydrolysis, endonucleolytic"}],"cellular_component":[{"id":"GO:0005737","label":"cytoplasm"},{"id":"GO:0016020","label":"membrane"},{"id":"GO:0045202","label":"synapse"}]},"interpro":[{"id":"IPR044925","name":"His-Me finger superfamily","type":"homologous_superfamily","start":57,"end":106},{"id":"IPR003615","name":"HNH nuclease","type":"domain","start":66,"end":105},{"id":"IPR002893","name":"Zinc finger, MYND-type","type":"domain","start":174,"end":212},{"id":"IPR032978","name":"Zinc finger MYND domain-containing protein 19","type":"family","start":1,"end":227}],"reasoning":"I begin with the domain architecture. The N-terminal half carries IPR044925 (His-Me finger superfamily, residues 57–106) overlapping IPR003615 (HNH nuclease domain, residues 66–105). The His-Me/HNH fold is a metal-coordinated endonuclease scaffold that typically cleaves nucleic acids by coordinating divalent cations to hydrolyze phosphodiester bonds. In many eukaryotic proteins this fold is repurposed as a nucleic-acid–binding or catalysis-impaired module, but its presence still encodes an intrinsic propensity to engage and, when catalytically competent, to endonucleolytically cleave RNA or DNA. The C-terminal half contains IPR002893 (Zinc finger, MYND-type, residues 174–212), a small cysteine-rich Zn-binding module that specializes in protein–protein interactions and recruitment of regulatory complexes. The full-length sequence is encompassed by IPR032978 (Zinc finger MYND domain-containing protein 19 family, residues 1–227), indicating a conserved two-module architecture: an N-terminal His-Me/HNH nuclease-like unit followed by a C-terminal MYND interaction hub.\n\nThis ordered layout dictates molecular function. The MYND domain creates a high-affinity platform for assembling multi-protein complexes, directly supporting GO:0005515 protein binding. The HNH/His-Me module supplies a nucleic-acid–engagement core that can position RNA for cleavage. Together, these modules cause a division of labor: the MYND domain recruits partners and the HNH fold confers nucleic-acid handling and, potentially, endonucleolytic chemistry.\n\nFrom function to process, the HNH nuclease fold mechanistically explains participation in RNA phosphodiester bond hydrolysis, endonucleolytic (GO:0090502). The architecture predisposes the protein to bind structured RNA and to catalyze or assist endonucleolytic events, even if catalysis occurs within larger ribonucleoprotein assemblies. The MYND domain’s scaffolding role likely tunes when and where cleavage is executed—either during RNA maturation/turnover or in specialized neuronal compartments.\n\nCellular location follows from the same logic. The absence of transmembrane segments and the presence of soluble interaction modules argue for a cytosolic protein, aligning with GO:0005737 cytoplasm. Neuronal enrichment and RNA-processing roles are consistent with localization to GO:0045202 synapse, where local RNA metabolism modulates synaptic function. The architecture also tolerates peripheral association with membranes via protein-mediated tethering rather than membrane insertion, supporting GO:0016020 membrane as a transient or indirect localization through adaptor binding.\n\nThese features suggest a mechanism: the N-terminal His-Me/HNH unit captures and positions RNA substrates, while the C-terminal MYND domain recruits effector complexes that either supply catalytic activity or regulate access to RNA. In neurons, this assembly could localize to synaptic cytoplasm to modulate RNA stability and translation. I therefore hypothesize interactions with cytosolic RNA decay and processing machinery (e.g., RNAi pathway components and Argonaute-family factors), cytoskeletal or membrane-proximal adaptors that anchor ribonucleoprotein assemblies at synapses, and synaptic scaffolds that concentrate these complexes near membranes. This cooperative assembly would enable context-dependent endonucleolysis and RNA remodeling in cytoplasm and synaptic regions.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q96E35.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q96E35"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q96E35/entry","atlas":"/p/Q96E35"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}