{"uniprot":"Q96IV6","gene":"FAXDC2","name":"Fatty acid hydroxylase domain-containing protein 2","organism":"Homo sapiens (Human)","status":"dark","length":333,"sequence":"MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFWQAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKNEPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTLIEEVLFYYSHRLLHHPTFYKKIHKKHHEWTAPIGVISLYAHPIEHAVSNMLPVIVGPLVMGSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTDTMFKQTKAYERHVLLLGFTPLSESIPDSPKRME","function_summary":"A membrane-associated regulator of hematopoiesis that assembles signaling and redox modules at the endoplasmic reticulum to promote megakaryocyte differentiation and elevate phosphorylation pathways. Its sterol/desaturase-like scaffold with a hydroxylase core positions it as a membrane-tethered hub that organizes protein assemblies rather than executing soluble catalysis. By recruiting and stabilizing cytosolic partners at the ER interface, it enhances kinase signaling cascades that drive hematopoietic lineage control.","plain_language":"FAXDC2 has barely been studied. The model's best guess: A membrane-associated regulator of hematopoiesis that assembles signaling and redox modules at the endoplasmic reticulum to promote megakaryocyte differentiation and elevate phosphorylation pathways. Its sterol/desaturase-like scaffold with a hydroxylase core positions it as a membrane-tethered hub that organizes protein assemblies rather than executing soluble catalysis.","uniprot_summary":"Involved in the regulation of hematopoiesis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0045639","label":"positive regulation of myeloid cell differentiation"},{"id":"GO:0001932","label":"regulation of protein phosphorylation"},{"id":"GO:0045652","label":"regulation of megakaryocyte differentiation"},{"id":"GO:0001934","label":"positive regulation of protein phosphorylation"}],"cellular_component":[{"id":"GO:0005737","label":"cytoplasm"}]},"interpro":[{"id":"IPR006694","name":"Fatty acid hydroxylase","type":"domain","start":176,"end":299},{"id":"IPR050307","name":"Sterol desaturase-related","type":"family","start":58,"end":304}],"reasoning":"I begin with the InterPro architecture. The polypeptide carries IPR050307 (Sterol desaturase-related family) spanning residues 58–304, and within this region sits IPR006694 (Fatty acid hydroxylase domain) from residues 176–299. This arrangement—an internal hydroxylase core embedded in a sterol-desaturase-like scaffold—defines a membrane-associated non-heme diiron enzyme superfamily that catalyzes oxygenation reactions on hydrophobic substrates. The broad “sterol desaturase-related” envelope positions the protein in a membrane redox enzyme lineage, while the fatty acid hydroxylase domain provides the catalytic heart that coordinates iron and activates molecular oxygen for hydroxylation or desaturation chemistry. The architecture therefore causes redox-coupled lipid/heme chemistry at a membrane interface and strongly favors a role that depends on assembling transient multiprotein complexes rather than soluble catalysis.\n\nFrom this domain logic, the most defensible immediate molecular function is multivalent protein association that organizes redox and signaling modules. This supports GO:0005515 protein binding as the operative molecular function, because membrane redox enzyme families frequently act as scaffolds or adaptors whose activity emerges from complex formation with cytosolic partners and membrane machineries.\n\nThe biological processes follow from how such membrane-tethered redox/scaffold modules tune signaling. First, the protein is described as a regulator of hematopoiesis and as a positive regulator of megakaryocyte differentiation (GO:0045639). A membrane-associated hydroxylase/scaffold can bias lineage decisions by modulating pathways that drive megakaryopoiesis; the domain architecture suits assembly of signaling hubs that tip fate toward platelet precursors. Second, it positively regulates protein phosphorylation (GO:0001934). A membrane redox platform can elevate kinase pathway output by stabilizing or recruiting kinases and their activators, thereby increasing phosphorylation flux. Third, it regulates protein phosphorylation more broadly (GO:0001932), consistent with a scaffold that tunes signal throughput rather than directly catalyzing phosphorylation.\n\nCellular location is inferred from the membrane-anchored redox architecture and the experimentally supported topology. The sterol desaturase-related fold and hydroxylase core both dictate a membrane-associated enzyme; the stated localization to the endoplasmic reticulum membrane and multi-pass membrane behavior align with this. While the catalytic core operates at the ER, soluble pools and interaction surfaces justify a cytoplasmic assignment (GO:0005737), because ER-associated complexes extend into the cytoplasmic face and relay signals outward.\n\nMechanistically, I hypothesize that the protein forms an ER-embedded signaling/redox hub that recruits cytosolic kinases and adaptors to amplify phosphorylation cascades governing hematopoietic lineage choice. Likely partners include ER-resident chaperones and redox enzymes that deliver substrates, together with cytoplasmic kinases whose activity is enhanced by proximity. This assembly would bias megakaryocyte differentiation and broadly elevate phosphorylation, explaining the observed hematopoietic regulatory roles.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q96IV6.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q96IV6"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q96IV6/entry","atlas":"/p/Q96IV6"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}