{"uniprot":"Q96PP4","gene":"TSGA13","name":"Testis-specific gene 13 protein","organism":"Homo sapiens (Human)","status":"dark","length":275,"sequence":"MSQKRQTKFQNGKSKTSENSSAKREKGMVVNSKEISDAVGQSKFVLENLRHYTVHPNLAQYYKPLKATALQKFLAQNRKNTSFMLKVTQYDQDKTLLIMTNNPPPCSITQQDKESASKYFSKELLLKVMESHHQHKPTENLWLPRMPQKKKLRSKLKPIFPLILSDDPTSKREQWFRFSTDNDFKSEGKYSKVYALRTQKKMYPQLTFAPVHERDMRKDASKKSASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVIG","function_summary":"A testis-restricted, soluble scaffold that operates during human sperm development by assembling binding-dependent complexes. It likely functions primarily through multivalent interactions to coordinate cytoplasmic and perimitochondrial assemblies that tune mitochondrial remodeling and energy supply during germ cell differentiation. Its distribution across cytoplasm and nucleoplasm, with additional association to mitochondria, positions it to couple gene-regulatory and RNA-handling modules with organelle dynamics essential for spermatogenesis.","plain_language":"TSGA13 has barely been studied. The model's best guess: A testis-restricted, soluble scaffold that operates during human sperm development by assembling binding-dependent complexes. It likely functions primarily through multivalent interactions to coordinate cytoplasmic and perimitochondrial assemblies that tune mitochondrial remodeling and energy supply during germ cell differentiation.","uniprot_summary":"May play a role in spermatogenesis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0007283","label":"spermatogenesis"}],"cellular_component":[{"id":"GO:0005737","label":"cytoplasm"},{"id":"GO:0005654","label":"nucleoplasm"},{"id":"GO:0005739","label":"mitochondrion"}]},"interpro":[{"id":"IPR029241","name":"Testis-specific gene 13 protein","type":"family","start":1,"end":274}],"reasoning":"I begin with the InterPro architecture: IPR029241 (Testis-specific gene 13 protein family) spans the entire polypeptide from residues 1–274, indicating a single-family signature that covers the full length without embedded catalytic domains. A full-length family envelope typically denotes a specialized, non-enzymatic scaffold/adaptor conserved in the male germline. The absence of enzymatic cores or transmembrane modules implies a soluble, interaction-centric protein whose primary chemistry is mediated through binding interfaces. This architecture causally supports a molecular role dominated by multivalent contacts, aligning with GO:0005515 protein binding as the operative molecular function.\n\nFrom this binding-centric scaffold, I infer function in germ cell development. A testis-restricted family signature that tracks across the entire sequence suggests evolutionary specialization for spermatogenic pathways. Such scaffolds often coordinate stage-specific assemblies that choreograph cytoskeletal remodeling, RNA handling, and organelle remodeling. This causal chain—full-length binding scaffold in a testis-restricted family—places the protein squarely in GO:0007283 spermatogenesis.\n\nCellular localization follows from how this scaffold operates. The soluble nature and interaction focus predict a cytoplasmic residency, consistent with GO:0005737 cytoplasm. The presence of nucleoplasmic signals in testis-specific scaffolds is common when they transiently chaperone transcriptional regulators or ribonucleoprotein assemblies that shuttle through the nucleus; this supports GO:0005654 nucleoplasm. Additionally, germ cell maturation entails pronounced mitochondrial remodeling, with mitochondria accumulating near the nuclear region and undergoing selective processing. A testis-restricted scaffold that binds partners and localizes to mitochondria is therefore mechanistically coherent with GO:0005739 mitochondrion. Together, these compartments outline a trajectory: cytoplasmic assembly and RNA/protein handling, nucleoplasmic coupling to gene-regulatory modules, and mitochondrial association during energy-demanding stages of germ cell differentiation.\n\nMechanistically, I hypothesize that the protein acts as a testis-specific adaptor that organizes cytoplasmic and perimitochondrial complexes during spermatogenesis. By concentrating binding surfaces, it likely nucleates assemblies that regulate mitochondrial distribution and metabolic tuning in late germ cell stages. This could involve transient interactions with nucleoplasmic regulators that specify spermatogenic programs and with mitochondrial outer-membrane or intermembrane-space factors that adjust ATP supply and reactive oxygen species handling. The predicted partners would include cytoskeletal and periaxonemal organizers, RNA-binding factors that chaperone germ-cell transcripts, and mitochondrial surface complexes that coordinate energy coupling—together forming a modular hub that times and positions mitochondrial remodeling during sperm development.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q96PP4.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q96PP4"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q96PP4/entry","atlas":"/p/Q96PP4"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}