{"uniprot":"Q96PS6","gene":"GAFA1","name":"Putative uncharacterized protein GAFA-1","organism":"Homo sapiens (Human)","status":"dark","length":74,"sequence":"MIKHSWIHLYVMASAMSSSPIFFFFQRWSLTLSLRLECSSAIIKPTAASNSCVQVNLPPSMCDYRHEPLCLAFL","function_summary":"A soluble human adaptor that concentrates binding interactions to regulate humoral antimicrobial defense. By shuttling and assembling regulatory complexes in the nucleus, it likely modulates transcriptional programs that drive antimicrobial peptide production and broader immune outputs. Its binding-driven scaffold architecture positions it to coordinate gene-regulatory modules with downstream effector pathways, thereby tuning the intensity and timing of innate and adaptive immune responses.","plain_language":"GAFA1 has barely been studied. The model's best guess: A soluble human adaptor that concentrates binding interactions to regulate humoral antimicrobial defense. By shuttling and assembling regulatory complexes in the nucleus, it likely modulates transcriptional programs that drive antimicrobial peptide production and broader immune outputs.","uniprot_summary":"May be involved in the innate and adaptive immune response.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0061844","label":"antimicrobial humoral immune response mediated by antimicrobial peptide"}],"cellular_component":[{"id":"GO:0005634","label":"nucleus"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding. The presence of only a generic protein-binding signature and the absence of catalytic or transmembrane domain calls indicate a soluble adaptor or scaffold rather than an enzyme or transporter. Such architectures typically mediate selective macromolecular interactions that regulate localization and signaling.\n\nFrom this binding-centric core, I infer molecular function first. A dedicated protein-binding capacity (GO:0005515) equips the protein to assemble transient complexes. This binding capacity can be used to shuttle between compartments and to couple transcriptional or signaling modules to effector pathways. The lack of enzymatic motifs argues that function arises from regulated interactions rather than chemistry.\n\nThis binding role causally links to the biological process of antimicrobial humoral defense. The process label GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide is consistent with a scaffold that promotes or coordinates pathways producing antimicrobial peptides. A binding-driven adaptor can tune transcription, processing, or trafficking of antimicrobial effectors in epithelial and immune contexts.\n\nCellular localization follows from the same logic. The protein is observed in the nucleus (GO:0005634), and a nuclear residence is mechanistically coherent with a binding scaffold that modulates gene expression programs tied to innate and adaptive immunity. A soluble, non-membranous architecture readily supports nuclear import and retention, allowing assembly of transcriptional complexes that drive antimicrobial peptide production and broader immune outputs.\n\nPutting these pieces together yields a mechanistic hypothesis. The protein acts as a nucleocytoplasmic adaptor that concentrates binding interactions to regulate antimicrobial peptide–dependent humoral immunity. In the nucleus, it likely associates with transcriptional regulators and chromatin-associated factors that induce antimicrobial and cytokine genes. By shuttling and binding partners, it coordinates transcriptional priming with downstream effector pathways. This model explains its nuclear localization, its binding-driven molecular function, and its role in antimicrobial humoral responses.\n\nFrom this mechanism, I hypothesize interaction partners that fit a nuclear, immune-governed scaffold: transcription factors and co-regulators that drive antimicrobial peptide and cytokine programs (e.g., NF-κB pathway components and STATs), chromatin remodelers that gate inducible defense genes, and adaptor proteins that couple nuclear signaling to cytoplasmic effector assembly. These interactions would collectively tune the amplitude and timing of humoral antimicrobial responses.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q96PS6.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q96PS6"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q96PS6/entry","atlas":"/p/Q96PS6"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}