{"uniprot":"Q99909","gene":"SSX3","name":"Protein SSX3","organism":"Homo sapiens (Human)","status":"dark","length":188,"sequence":"MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSFMRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLCPPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE","function_summary":"A nuclear transcriptional repressor that uses an N-terminal repression module to assemble corepressor complexes and a C-terminal chromatin-engagement motif to stabilize silencing on target loci. By recruiting chromatin-modifying assemblies that deposit repressive marks and remove acetylation, it suppresses RNA polymerase II–driven gene expression within the nucleus through multivalent protein interactions and chromatin tethering.","plain_language":"SSX3 has barely been studied. The model's best guess: A nuclear transcriptional repressor that uses an N-terminal repression module to assemble corepressor complexes and a C-terminal chromatin-engagement motif to stabilize silencing on target loci. By recruiting chromatin-modifying assemblies that deposit repressive marks and remove acetylation, it suppresses RNA polymerase II–driven gene expression within the nucleus through multivalent protein interactions and chromatin tethering.","uniprot_summary":"Transcriptional repressor.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0000122","label":"negative regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005634","label":"nucleus"}]},"interpro":[{"id":"IPR036051","name":"Krueppel-associated box domain superfamily","type":"homologous_superfamily","start":21,"end":71},{"id":"IPR003655","name":"Ancestral KRAB domain","type":"domain","start":20,"end":83},{"id":"IPR001909","name":"Krueppel-associated box","type":"domain","start":23,"end":82},{"id":"IPR019041","name":"SSXRD motif","type":"conserved_site","start":162,"end":187}],"reasoning":"I begin with the InterPro architecture. The N-terminal third of the protein is densely packed with KRAB signatures: IPR003655 (Ancestral KRAB domain, residues 20–83) overlaps with IPR001909 (Krueppel-associated box, residues 23–82) and sits within the broader IPR036051 (Krueppel-associated box domain superfamily, residues 21–71). This layered annotation establishes a canonical KRAB repression module positioned near the N-terminus. KRAB domains nucleate transcriptional silencing by recruiting corepressor assemblies and chromatin-modifying enzymes. The C-terminal half carries IPR019041 (SSXRD motif, residues 162–187), a conserved site characteristic of SSX family proteins that mediates chromatin-associated interactions and stabilizes repressive complexes. The ordered layout—an N-terminal KRAB repression engine followed by a C-terminal SSXRD chromatin-engagement motif—creates a bipartite silencing scaffold: the KRAB module drives assembly of repression machinery, while SSXRD refines chromatin targeting and retention.\n\nThis architecture dictates molecular function as protein binding (GO:0005515). KRAB domains achieve repression by binding corepressors and adaptor proteins rather than DNA directly; the SSXRD motif further expands binding capacity to chromatin-associated partners. Together, these modules cause multivalent protein–protein interactions that recruit and stabilize silencing complexes.\n\nFrom this binding-driven mechanism, the biological process follows: the KRAB-centered scaffold assembles factors that attenuate RNA polymerase II transcription, producing negative regulation of transcription by RNA polymerase II (GO:0000122). KRAB-driven pathways typically install H3K9 methylation and histone deacetylation, which compact chromatin and suppress initiation and elongation. The SSXRD motif strengthens this outcome by anchoring the complex to chromatin and coordinating accessory repressors.\n\nCellular localization is dictated by function and motifs. KRAB and SSXRD modules operate on chromatin and transcriptional machinery; thus the protein resides in the nucleus (GO:0005634). The absence of transmembrane segments and the presence of chromatin-centric motifs reinforce a soluble nuclear localization consistent with transcriptional repression.\n\nMechanistically, I hypothesize that the KRAB core recruits a corepressor hub that seeds heterochromatin formation, while the SSXRD motif fine-tunes chromatin engagement and pathway specificity. Likely partners include TRIM28/KAP1 as the primary KRAB adaptor, SETDB1 as the H3K9 methyltransferase, HP1 proteins that read H3K9me marks, and HDAC-containing assemblies that deacetylate histones. Additional chromatin regulators and sequence-specific transcription factors may transiently dock to guide locus-specific repression. This cooperative assembly explains how the protein functions as a nuclear transcriptional repressor and how its activity propagates silencing across target loci.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q99909.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q99909"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q99909/entry","atlas":"/p/Q99909"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}