{"uniprot":"Q9BPX5","gene":"ARPC5L","name":"Actin-related protein 2/3 complex subunit 5-like protein","organism":"Homo sapiens (Human)","status":"dark","length":153,"sequence":"MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV","function_summary":"A soluble cytoplasmic subunit of the actin-branching machine that stabilizes and positions the Arp2/3 assembly to initiate new actin branches when activated by nucleation-promoting factors. By providing a rigid binding scaffold, it organizes cytoskeletal remodeling that underlies cell migration and adhesion dynamics at focal adhesions. Its soluble architecture and association with adhesion and vesicle pathways account for its presence in the cytoskeleton-rich cytoplasm and in extracellular vesicles.","plain_language":"ARPC5L has barely been studied. The model's best guess: A soluble cytoplasmic subunit of the actin-branching machine that stabilizes and positions the Arp2/3 assembly to initiate new actin branches when activated by nucleation-promoting factors. By providing a rigid binding scaffold, it organizes cytoskeletal remodeling that underlies cell migration and adhesion dynamics at focal adhesions.","uniprot_summary":"May be involved in cell motility.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0016477","label":"cell migration"},{"id":"GO:0034314","label":"Arp2/3 complex-mediated actin nucleation"}],"cellular_component":[{"id":"GO:0070062","label":"extracellular exosome"},{"id":"GO:0005925","label":"focal adhesion"}]},"interpro":[{"id":"IPR036743","name":"Actin-related protein 2/3 complex subunit 5 superfamily","type":"homologous_superfamily","start":1,"end":153},{"id":"IPR006789","name":"Actin-related protein 2/3 complex subunit 5","type":"family","start":7,"end":153}],"reasoning":"I begin with the InterPro architecture. The sequence is fully covered by IPR036743 (Actin-related protein 2/3 complex subunit 5 superfamily, residues 1–153) and by the nested IPR006789 (Actin-related protein 2/3 complex subunit 5 family, residues 7–153). This compact, conserved ARPC5/ARPC-5 fold lacks catalytic motifs and instead forms a rigid β-sandwich-like scaffold typical of obligate complex subunits. The tandem of a superfamily envelope (IPR036743) and a family-defining core (IPR006789) across essentially the entire polypeptide indicates a structurally specialized adaptor that stabilizes and positions other Arp2/3 subunits rather than acting enzymatically. Such an architecture enforces multivalent contacts with partner proteins, directly supporting GO:0005515 protein binding as the primary molecular function.\n\nFrom this scaffolded binding role, I infer the biological processes governed by the Arp2/3 assembly. The ARPC5 fold is known to buttress the actin-nucleating core of the Arp2/3 complex, which initiates new actin branches when activated by nucleation-promoting factors. This structural contribution causally enables GO:0034314 Arp2/3 complex-mediated actin nucleation. Branch formation and filament turnover remodel the cytoskeleton, driving membrane protrusion and traction; thus the same nucleation mechanism propagates to GO:0016477 cell migration. The causal chain runs from a non-catalytic adaptor domain that stabilizes the nucleator, to actin filament branching, and onward to migratory behavior and adhesion dynamics.\n\nCellular placement follows from where actin remodeling is executed. The absence of transmembrane features and the soluble scaffold nature point to cytoplasmic residency, consistent with cytoplasm/cytoskeleton localization. Actin remodeling at adhesion sites positions the complex at GO:0005925 focal adhesion, where branched networks couple to integrin-based adhesion and turnover. Additionally, cytoskeleton-regulatory assemblies are frequently packaged into extracellular vesicles; this explains detection in GO:0070062 extracellular exosome, reflecting export of cytoskeletal regulators rather than a membrane-embedded role.\n\nMechanistically, I hypothesize that this subunit stabilizes the Arp2/3 core and tunes its activation threshold by nucleation-promoting factors. By binding partner subunits and transiently engaging actin monomers and filament ends, it biases branch formation at adhesion-coupled membranes. Likely interaction partners include other Arp2/3 subunits (for complex integrity), nucleation-promoting factors such as WASP/N-WASP and WAVE/Scar complexes that deliver activation cues, and adhesion-associated adaptors that localize the complex to focal adhesions. Together, these interactions coordinate cytoplasmic actin assembly with adhesion and vesicle pathways, explaining both migratory and exosomal associations.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9BPX5.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9BPX5"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9BPX5/entry","atlas":"/p/Q9BPX5"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}