{"uniprot":"Q9BQ75","gene":"CMSS1","name":"Protein CMSS1","organism":"Homo sapiens (Human)","status":"dark","length":279,"sequence":"MADDLGDEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKPGLPEDLQKLMKDYYSSRRLVIELEELNLPDSCFLKANDLTHSLSSYLKEICPKWVKLRKNHSEKKSVLMLIICSSAVRALELIRSMTAFRGDGKVIKLFAKHIKVQAQVKLLEKRVVHLGVGTPGRIKELVKQGGLNLSPLKFLVFDWNWRDQKLRRMMDIPEIRKEVFELLEMGVLSLCKSESLKLGLF","function_summary":"A predominantly nuclear RNA-processing factor that assembles and remodels ribonucleoprotein complexes to fine-tune pre-mRNA splicing and broader RNA metabolism. Its central nucleotide-binding core likely acts as a conformational switch that modulates affinity for RNA and partner proteins, enabling dynamic assembly of spliceosomal machinery in the nucleoplasm and nucleolus while maintaining a soluble cytosolic pool. By coordinating these RNA-centric assemblies, it influences pathways that govern cell growth and differentiation.","plain_language":"CMSS1 has barely been studied. The model's best guess: A predominantly nuclear RNA-processing factor that assembles and remodels ribonucleoprotein complexes to fine-tune pre-mRNA splicing and broader RNA metabolism. Its central nucleotide-binding core likely acts as a conformational switch that modulates affinity for RNA and partner proteins, enabling dynamic assembly of spliceosomal machinery in the nucleoplasm and nucleolus while maintaining a soluble cytosolic pool.","uniprot_summary":"Involved in RNA metabolism and cell growth and differentiation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"},{"id":"GO:0003723","label":"RNA binding"}],"biological_process":[{"id":"GO:0043484","label":"regulation of RNA splicing"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005654","label":"nucleoplasm"},{"id":"GO:0005730","label":"nucleolus"}]},"interpro":[{"id":"IPR027417","name":"P-loop containing nucleoside triphosphate hydrolase","type":"homologous_superfamily","start":131,"end":239},{"id":"IPR032704","name":"Protein Cms1","type":"family","start":1,"end":279}],"reasoning":"I begin with the InterPro architecture. The sequence is covered end-to-end by IPR032704 (Protein Cms1 family, residues 1–279), placing the protein within the conserved Cms1/RBMX family that modulates RNA processing. Embedded within this scaffold, residues 131–239 form IPR027417 (P-loop containing nucleoside triphosphate hydrolase homologous superfamily). This fold typically binds and sometimes hydrolyzes NTPs to drive conformational switching. In Cms1/RBMX proteins, the P-loop NTPase-like core often functions as an ATP/NTP-responsive RNA/protein interaction module rather than a high-flux enzyme. The ordered layout—an N-terminal Cms1 family framework that cradles a central P-loop NTP-binding core—creates a nucleic-acid–responsive assembly platform.\n\nThis architecture causally supports two molecular activities. First, the Cms1 family scaffold and basic surfaces commonly mediate RNA contacts, consistent with GO:0003723 RNA binding. Second, the extended family framework and switchable P-loop core provide multivalent interfaces for assembling ribonucleoprotein complexes, aligning with GO:0005515 protein binding. Together, these features define a modular RNP-organizing protein that couples nucleotide-sensitive conformational changes to RNA and protein engagement.\n\nFrom these molecular functions, the biological role follows. Cms1-family factors are known to tune pre-mRNA maturation. An RNA-binding, ATP/NTP-responsive scaffold is well suited to regulate spliceosome assembly and splice-site selection, which maps to GO:0043484 regulation of RNA splicing. The same RNA-centric mechanism readily extends to broader RNA metabolism and ribosome biogenesis pathways, explaining why perturbations can alter cell growth and differentiation.\n\nCellular localization is dictated by where RNP assembly and pre-mRNA processing occur. The nucleoplasm is the primary site of spliceosome function, matching GO:0005654 nucleoplasm. The nucleolus is a logical secondary hub for ribosome biogenesis and RNP trafficking, supporting GO:0005730 nucleolus. A soluble pool in the cytosol (GO:0005829 cytosol) is expected for dynamic exchange with cytoplasmic RNP pathways and translation-coupled RNA turnover. This distribution coheres with a predominantly nuclear role and transient cytosolic shuttling.\n\nMechanistically, I hypothesize that the P-loop NTPase-like core acts as a molecular switch that modulates affinity for pre-mRNA and spliceosomal components. In its NTP-bound state, the protein stabilizes RNP assemblies; in the ADP/ATP-bound equilibrium, it releases complexes to fine-tune splice-site choice. Likely interaction partners include spliceosome constituents (e.g., U2AF and SF3 complexes), serine/arginine-rich splicing factors, and nucleolar RNP assembly proteins. Through these assemblies, the protein coordinates nuclear RNA processing with broader cellular programs that govern cell growth and differentiation.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9BQ75.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9BQ75"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9BQ75/entry","atlas":"/p/Q9BQ75"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}