{"uniprot":"Q9BQY9","gene":"DBNDD2","name":"Dysbindin domain-containing protein 2","organism":"Homo sapiens (Human)","status":"dark","length":259,"sequence":"MGAGNFLTALEVPVAALAGAASDRRASCERVSPPPPLPHFRLPPLPRSRLPGPVSRPEPGAPLLGCWLQWGAPSPGPLCLLFRLCSCTCFAPLPAGADMDPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS","function_summary":"A soluble scaffold that assembles higher-order complexes controlling vesicle-associated trafficking and signaling. It concentrates in the cytosol and nucleoplasm and transiently associates with cytoplasmic and secretory vesicles, where it organizes cargo-sorting assemblies that shape membrane and neurotransmitter pathway flow. By positioning and sequestering pathway components, it dampens kinase activity and stabilizes trafficking hubs that govern polarized delivery of membrane proteins.","plain_language":"DBNDD2 has barely been studied. The model's best guess: A soluble scaffold that assembles higher-order complexes controlling vesicle-associated trafficking and signaling. It concentrates in the cytosol and nucleoplasm and transiently associates with cytoplasmic and secretory vesicles, where it organizes cargo-sorting assemblies that shape membrane and neurotransmitter pathway flow.","uniprot_summary":"May be involved in vesicle trafficking.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0006469","label":"negative regulation of protein kinase activity"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR007531","name":"Dysbindin","type":"family","start":64,"end":258}],"reasoning":"I begin with the InterPro architecture: a single annotated module, IPR007531 (Dysbindin family) spanning residues 64–258, occupies the core of the polypeptide. Dysbindin-family signatures denote a soluble, coiled-coil–rich scaffold that assembles higher-order complexes rather than catalyzing chemistry. The absence of enzymatic motifs and the dominance of a family-level scaffolding domain argue that this protein’s primary molecular role is multivalent assembly—consistent with GO:0005515 protein binding as the operative molecular function.\n\nA dysbindin-class scaffold typically nucleates trafficking and signaling assemblies. Such scaffolds regulate pathway flux by positioning effectors and modulating their accessibility. This architecture naturally supports negative control over kinase pathways: by sequestering or spatially constraining kinases and their adaptors, the scaffold can dampen catalytic throughput. That causal logic aligns with GO:0006469 negative regulation of protein kinase activity and explains how a non-enzymatic hub can tune phosphorylation cascades.\n\nThe cellular geography follows from this scaffold logic and the observed distribution. A soluble dysbindin-family core predicts a cytosolic residence, matching GO:0005829 cytosol and the broader cytoplasmic annotation. The presence in GO:0005654 nucleoplasm indicates nucleocytoplasmic shuttling—common for assembly factors that coordinate transcriptional and trafficking programs. The additional localization to cytoplasmic vesicles and secretory vesicles indicates that the scaffold transiently docks to vesicular membranes via partner-mediated recruitment, consistent with roles in neurotransmitter and membrane protein trafficking.\n\nMechanistically, the dysbindin-family scaffold provides a platform that couples vesicle-associated sorting to kinase pathway tuning. By assembling cargo-recognition modules and adaptor complexes on cytoplasmic vesicles and secretory vesicles, it can bias cargo flux and membrane composition. In neurons and secretory cells, this assembly function plausibly supports dopamine and glutamate handling and the polarized delivery of membrane proteins. Through spatial sequestration and adaptor-mediated buffering of kinases and their regulators, the scaffold imposes negative regulation on kinase activity, thereby stabilizing trafficking hubs and signaling nodes.\n\nFrom this chain of inference, I hypothesize that the protein forms a core subunit of a vesicle-associated complex that binds multiple partners to coordinate cargo sorting and signaling restraint. Likely interaction partners include other dysbindin-complex constituents and trafficking adaptors that together anchor the scaffold to vesicles and tune kinase pathways in the cytosol and nucleoplasm.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9BQY9.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9BQY9"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9BQY9/entry","atlas":"/p/Q9BQY9"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}