{"uniprot":"Q9BSG0","gene":"PRADC1","name":"Protease-associated domain-containing protein 1","organism":"Homo sapiens (Human)","status":"dark","length":188,"sequence":"MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW","function_summary":"A human PA-domain scaffold that operates outside the cell to organize binding-driven signaling assemblies. By using a protease-associated binding module to engage extracellular and pericellular partners, it likely modulates receptor and protease networks that influence survival pathways, thereby tuning apoptosis-related decisions in the extracellular environment.","plain_language":"PRADC1 has barely been studied. The model's best guess: A human PA-domain scaffold that operates outside the cell to organize binding-driven signaling assemblies. By using a protease-associated binding module to engage extracellular and pericellular partners, it likely modulates receptor and protease networks that influence survival pathways, thereby tuning apoptosis-related decisions in the extracellular environment.","uniprot_summary":"Probable extracellular or pericellular protein.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0008219","label":"cell death"}],"cellular_component":[{"id":"GO:0005576","label":"extracellular region"}]},"interpro":[{"id":"IPR046450","name":"PA domain superfamily","type":"homologous_superfamily","start":80,"end":163},{"id":"IPR037323","name":"PRADC1-like protein, PA domain","type":"domain","start":51,"end":168},{"id":"IPR003137","name":"PA domain","type":"domain","start":65,"end":149}],"reasoning":"I begin with the InterPro architecture. Three PA-domain signatures dominate the core of the polypeptide: IPR037323 (PRADC1-like protein, PA domain, residues 51–168) sits centrally and is flanked and reinforced by IPR003137 (PA domain, residues 65–149) and the broader IPR046450 (PA domain superfamily, residues 80–163). This layered annotation indicates a single, well-formed PA (protease-associated) domain that occupies the middle of the sequence. PA domains are non-catalytic binding modules that create high-affinity, often acidic-pocket interfaces for protein–protein interactions and for docking to protease or receptor surfaces. The absence of any catalytic signatures and the presence of a solitary PA module argue that this protein functions primarily as a binding/scaffolding factor rather than an enzyme.\n\nFrom this architecture, the molecular function resolves to protein binding (GO:0005515). The PA domain’s established role as a ligand- or protease-docking module causally explains a binding-centric activity: it stabilizes transient complexes with extracellular or pericellular partners and modulates their assembly and signaling.\n\nConnecting function to process, PA-domain scaffolds frequently tune extracellular signaling pathways that govern survival and death decisions. A binding-driven mechanism that assembles or presents pro- or anti-apoptotic cues naturally feeds into cell death pathways, aligning with GO:0008219 cell death. The PA domain’s propensity to localize near proteolytic and receptor systems suggests it can either potentiate extracellular matrix remodeling and receptor clustering that trigger apoptosis or restrain pro-death protease cascades—either route is consistent with a binding-mediated control point in death signaling.\n\nCellular location follows from the PA domain’s extracellular-facing biology. While many PA-domain proteins are secreted or peripherally associated with the cell surface, their functional interfaces are adapted to the extracellular milieu. This architecture and signaling role support an extracellular residency, consistent with GO:0005576 extracellular region. A secreted or surface-tethered state allows the protein to encounter and organize ligand–receptor–protease assemblies that dictate tissue-level responses and apoptosis.\n\nMechanistically, I hypothesize that the PA domain forms a soluble or pericellular scaffold that binds proteases and cell-surface receptors to tune extracellular signaling thresholds. By clustering or presenting partners, it can bias pathways toward or away from apoptosis. Likely interaction partners include extracellular matrix-associated proteins and membrane receptors whose ectodomains or shed fragments provide PA-domain docking sites; candidate classes include protease targets and adhesion/signaling receptors that govern survival cues. This binding-centered, extracellular scaffold model coherently explains the protein’s inferred molecular function, its role in cell death, and its extracellular localization.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9BSG0.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9BSG0"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9BSG0/entry","atlas":"/p/Q9BSG0"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}