{"uniprot":"Q9BSH3","gene":"NICN1","name":"Nicolin-1","organism":"Homo sapiens (Human)","status":"dark","length":213,"sequence":"MSRVLVPCHVKGSVALQVGDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHTPAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFTVEELQIYQQGPKSPSVTFPKWLSHPVPCEQPALLREGLPDPSRVSSEVQQMWALTEMIRASHTSARIGRFDVDGCYDLNLLSYT","function_summary":"A soluble nuclear adaptor that organizes nucleoplasmic ribonucleoprotein assemblies controlling small nuclear RNA maturation and utilization. By providing a multivalent binding platform rather than catalytic activity, it stabilizes and times the assembly of snRNA-containing particles within the nucleus, thereby tuning RNA processing pathways and ensuring efficient formation of spliceosome-related complexes.","plain_language":"NICN1 has barely been studied. The model's best guess: A soluble nuclear adaptor that organizes nucleoplasmic ribonucleoprotein assemblies controlling small nuclear RNA maturation and utilization. By providing a multivalent binding platform rather than catalytic activity, it stabilizes and times the assembly of snRNA-containing particles within the nucleus, thereby tuning RNA processing pathways and ensuring efficient formation of spliceosome-related complexes.","uniprot_summary":"May be involved in RNA processing.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0016180","label":"snRNA processing"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR040235","name":"Nicolin-1","type":"family","start":1,"end":213}],"reasoning":"I begin with the InterPro architecture: a single family signature IPR040235 (Nicolin-1 family) spanning residues 1–213, covering essentially the entire polypeptide. A full-length family domain without embedded catalytic cores or transmembrane segments indicates a soluble, non-enzymatic nuclear factor. Such single-domain scaffolds typically mediate macromolecular assembly through multivalent surfaces rather than catalysis, which causally supports a binding-centric molecular role.\n\nFrom this architecture, the most direct molecular function is protein binding (GO:0005515). A full-length family profile that defines a conserved nuclear group implies a modular interaction platform that organizes other nuclear proteins. The absence of enzymatic motifs and the likely basic, low-complexity character typical of such families further reinforce a role in assembling ribonucleoprotein complexes.\n\nThis binding-centric activity connects to snRNA processing (GO:0016180). The Nicolin-1 family association and nuclear solubility position the protein in pathways that mature small nuclear RNAs and coordinate their incorporation into spliceosomal assemblies. A non-catalytic scaffold that stabilizes or times RNP maturation naturally exerts control over snRNA biogenesis and turnover, thereby shaping downstream RNA processing flux.\n\nCellular localization follows from the soluble, non-membranous architecture and nuclear function: the nucleoplasm (GO:0005654). A nucleoplasmic residency is necessary for efficient access to nascent transcripts and assembly hubs for spliceosomal components. This soluble nuclear environment provides the staging ground for dynamic RNP assembly and surveillance.\n\nMechanistically, a plausible model is that the protein forms a nucleoplasmic adaptor that couples transcription-proximal snRNA handling to spliceosome assembly. By binding multiple partners, it could chaperone the maturation and trafficking of snRNA-containing particles, buffering them against premature export and coordinating their availability for splicing. Likely interaction partners include nuclear RNA-processing assemblies and their adaptors—candidates such as the transient RNA polymerase II-associated complex (TRAMP) and nuclear exosome modules for RNA surveillance, the SMN complex for snRNP assembly, and core spliceosomal proteins. Through these associations, the protein would tune snRNA processing efficiency and fidelity within the nucleoplasm.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9BSH3.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9BSH3"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9BSH3/entry","atlas":"/p/Q9BSH3"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}