{"uniprot":"Q9BTT4","gene":"MED10","name":"Mediator of RNA polymerase II transcription subunit 10","organism":"Homo sapiens (Human)","status":"dark","length":135,"sequence":"MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS","function_summary":"A nuclear scaffold subunit of the core Mediator assembly that organizes protein–protein interfaces to recruit and stabilize the RNA polymerase II initiation machinery. By supporting assembly of the preinitiation complex and transmitting signals from transcriptional activators to polymerase and general factors, it enhances promoter competence and initiation efficiency within the nucleoplasm.","plain_language":"MED10 has barely been studied. The model's best guess: A nuclear scaffold subunit of the core Mediator assembly that organizes protein–protein interfaces to recruit and stabilize the RNA polymerase II initiation machinery. By supporting assembly of the preinitiation complex and transmitting signals from transcriptional activators to polymerase and general factors, it enhances promoter competence and initiation efficiency within the nucleoplasm.","uniprot_summary":"Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0060261","label":"positive regulation of transcription initiation by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"},{"id":"GO:0070847","label":"core mediator complex"}]},"interpro":[{"id":"IPR019145","name":"Mediator complex, subunit Med10","type":"family","start":9,"end":125}],"reasoning":"I begin with the InterPro architecture: a single conserved module, IPR019145 (Mediator complex, subunit Med10 family) spanning residues 9–125. This compact, centrally placed family signature defines a canonical Mediator core subunit. The absence of catalytic motifs and the presence of a sole scaffolding/assembly domain indicate a non-enzymatic role that stabilizes multiprotein assemblies. Such an architecture causes multivalent protein–protein interactions rather than direct catalysis, aligning with GO:0005515 protein binding as the primary molecular function.\n\nA Med10-family core subunit is a structural element of the core Mediator complex that nucleates and stabilizes higher-order assemblies required for RNA polymerase II initiation. By providing a rigid yet adaptable scaffold, this subunit positions regulatory factors and the preinitiation complex to promote assembly and firing at promoters. This causal role in assembling initiation-competent machinery directly supports GO:0060261 positive regulation of transcription initiation by RNA polymerase II.\n\nCellular localization follows from function and architecture. Mediator core subunits operate within the soluble nuclear interior where preinitiation complexes form and remodel; thus the protein resides in the GO:0005654 nucleoplasm. Its stable incorporation into the core Mediator assembly places it within GO:0070847 core mediator complex. The experimentally observed nuclear residency is consistent with this soluble nuclear scaffold.\n\nMechanistically, the Med10-family module forms part of the core that bridges transcriptional activators and the basal transcription apparatus. By stabilizing inter-subunit interfaces, it enables Mediator to undergo promoter-dependent conformations that recruit and position RNA polymerase II and general transcription factors. I hypothesize that this subunit contacts neighboring core Mediator components to transmit allosteric signals from activator-binding surfaces to the polymerase-facing face, thereby enhancing initiation efficiency. Likely interaction partners include other core Mediator subunits and basal initiation machinery; transient associations with sequence-specific activators and chromatin remodelers would further tune promoter-specific assembly and activity.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9BTT4.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9BTT4"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9BTT4/entry","atlas":"/p/Q9BTT4"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}