{"uniprot":"Q9BUT9","gene":"MCRIP2","name":"MAPK regulated corepressor interacting protein 2","organism":"Homo sapiens (Human)","status":"dark","length":160,"sequence":"MYTITKGPSKLVAQRRTGPTQQQVEGRLGELLKCRQPAPPTSQPPRAQPFAQPPGPWPLSSPGPRLVFNRVNGRRAPSTSPSFEGTQETYTVAHEENVRFVSEAWQQVQQQLDGGPAGEGGPRPVQYVERTPNPRLQNFVPIDLDEWWAQQFLARITSCS","function_summary":"A MAPK-responsive scaffold that assembles regulatory complexes to coordinate transcriptional repression with cytoplasmic RNA control. It shuttles between the nucleus and cytoplasm, where it nucleates stress-responsive ribonucleoprotein assemblies that transiently inhibit translation and facilitate recovery. By coupling signaling-driven repression to RNA handling and ribonucleoprotein granule dynamics, it tunes gene output and indirectly supports mitochondrial organization and biogenesis.","plain_language":"MCRIP2 has barely been studied. The model's best guess: A MAPK-responsive scaffold that assembles regulatory complexes to coordinate transcriptional repression with cytoplasmic RNA control. It shuttles between the nucleus and cytoplasm, where it nucleates stress-responsive ribonucleoprotein assemblies that transiently inhibit translation and facilitate recovery.","uniprot_summary":"May be involved in transcriptional repression.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0010628","label":"positive regulation of gene expression"},{"id":"GO:0010629","label":"negative regulation of gene expression"},{"id":"GO:0017148","label":"negative regulation of translation"},{"id":"GO:0007005","label":"mitochondrion organization"},{"id":"GO:0045727","label":"positive regulation of translation"}],"cellular_component":[{"id":"GO:0010494","label":"cytoplasmic stress granule"},{"id":"GO:0005634","label":"nucleus"}]},"interpro":[{"id":"IPR029428","name":"Mapk-regulated corepressor-interacting protein","type":"family","start":62,"end":157}],"reasoning":"I begin with the InterPro architecture: a single annotated region IPR029428 (Mapk-regulated corepressor-interacting protein family) spanning residues 62–157. This centrally placed family signature defines a MAPK-responsive scaffold that binds transcriptional corepressors and other partners. The absence of catalytic domains and the presence of a corepressor-interacting module argue that the polypeptide functions primarily through regulated protein–protein interactions rather than enzymatic chemistry. This architecture causally supports a molecular role centered on multivalent assembly and modulation of ribonucleoprotein and chromatin-associated complexes, aligning with GO:0005515 protein binding as the operative molecular function.\n\nFrom this scaffold, two functional axes emerge that map onto RNA fate and organelle biogenesis. First, the MAPK-regulated corepressor-interacting family is known to couple signaling pathways to gene-expression control. Such coupling explains how the protein can both repress and enhance gene output depending on context, matching GO:0010629 negative regulation of gene expression and GO:0010628 positive regulation of gene expression. Second, the same interaction-centric architecture readily supports assembly into cytoplasmic ribonucleoprotein condensates. Stress-responsive RNA-binding scaffolds nucleate translation-control hubs, which directly accounts for GO:0017148 negative regulation of translation and for residence within GO:0010494 cytoplasmic stress granule. By toggling between repression and recovery phases in these granules, the protein can transiently halt and then restore protein synthesis.\n\nThe biological process GO:0007005 mitochondrion organization is mechanistically explained by the coupling of cytosolic translation control and RNA handling to mitochondrial biogenesis. Stress granule residency and MAPK signaling provide routes to coordinate nuclear-encoded mitochondrial protein production with organelle assembly. A scaffold that tunes translation and mRNA trafficking upstream of mitochondrial function can thereby drive organelle organization and homeostasis.\n\nCellular localization follows directly from these assemblies and regulatory inputs. The corepressor-interacting family signature and transcriptional modulation place the protein in the GO:0005634 nucleus, where it can interface with chromatin-associated repression machinery. Its stress-responsive RNP assembly role situates it in the cytoplasm and specifically within cytoplasmic stress granules (GO:0010494). The experimentally observed nucleocytoplasmic distribution is thus a causal consequence of MAPK-governed shuttling between nuclear repression complexes and cytoplasmic translation-control hubs.\n\nPutting these lines together yields a coherent mechanism: a MAPK-sensitive scaffold that binds partners through IPR029428 to coordinate transcriptional repression with cytoplasmic RNA fate. In the nucleus, it associates with corepressor assemblies to dampen gene expression; upon stress or signaling cues, it relocates to stress granules to transiently inhibit translation and reorganize mRNA cohorts. Through this signaling-to-RNP axis, it indirectly governs mitochondrial organization by modulating the supply and assembly of mitochondrial components.\n\nThis model predicts interaction partners that fit each compartment and process. In the nucleus, likely associates include corepressor complexes and MAPK pathway kinases. In the cytoplasm and stress granules, partners plausibly include translation initiation factors and RNA granule nucleators. Together, these assemblies explain how a single MAPK-regulated scaffold can exert both negative and positive control over gene expression, inhibit translation under stress, and influence mitochondrial organization via nucleocytoplasmic coordination.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9BUT9.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9BUT9"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9BUT9/entry","atlas":"/p/Q9BUT9"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}