{"uniprot":"Q9BX73","gene":"TM2D2","name":"TM2 domain-containing protein 2","organism":"Homo sapiens (Human)","status":"dark","length":214,"sequence":"MVLGGCPVSYLLLCGQAALLLGNLLLLHCVSRSHSQNATAEPELTSAGAAQPEGPGGAASWEYGDPHSPVILCSYLPDEFIECEDPVDHVGNATASQELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYTGHYFITTLLYSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILLITGGLMPSDGSNWCTVY","function_summary":"A human multi-pass membrane protein that assembles signaling complexes at the cell surface to modulate receptor-driven pathways. Its membrane-embedded scaffold and cytosolic interaction surfaces enable binding-driven regulation of receptor-proximal assemblies, tuning the amplitude and timing of heterotrimeric G protein signaling at the plasma membrane.","plain_language":"TM2D2 has barely been studied. The model's best guess: A human multi-pass membrane protein that assembles signaling complexes at the cell surface to modulate receptor-driven pathways. Its membrane-embedded scaffold and cytosolic interaction surfaces enable binding-driven regulation of receptor-proximal assemblies, tuning the amplitude and timing of heterotrimeric G protein signaling at the plasma membrane.","uniprot_summary":"May be involved in signal transduction.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0008277","label":"regulation of G protein-coupled receptor signaling pathway"}],"cellular_component":[{"id":"GO:0005886","label":"plasma membrane"}]},"interpro":[{"id":"IPR007829","name":"TM2 domain","type":"domain","start":147,"end":195},{"id":"IPR050932","name":"TM2 domain-containing protein 1-3-like","type":"family","start":69,"end":213}],"reasoning":"I begin with the InterPro architecture. The sequence contains IPR050932 (TM2 domain-containing protein 1-3-like family) spanning residues 69–213, which frames the overall fold and indicates a compact, membrane-associated module characteristic of the TM2D family. Nested within this, IPR007829 (TM2 domain) occupies residues 147–195, marking a hydrophobic transmembrane hairpin that drives membrane insertion and oligomerization. This ordered layout—an extended TM2D-family scaffold that houses a defined TM2 core—causes a multi-pass membrane topology with short luminal/extracellular loops and cytosolic tails suited for assembling signaling complexes rather than catalysis.\n\nSuch a membrane-embedded scaffold naturally mediates protein-protein interactions through its cytosolic regions and membrane-proximal surfaces, supporting GO:0005515 protein binding as the molecular function. The absence of catalytic motifs and the presence of a dedicated TM2 module argue that function arises from binding-driven regulation of neighboring receptors and effectors.\n\nFrom this binding-centric membrane platform, the most parsimonious role is modulation of heterotrimeric G protein pathways. TM2D-family proteins frequently tune receptor-proximal assemblies; here, the architecture enables two coupled activities: clustering of GPCR-associated components and coupling to endocytic/adaptor machinery. These features causally position the protein as a regulator of G protein-coupled receptor signaling, aligning with GO:0008277 regulation of G protein-coupled receptor signaling pathway. By stabilizing or biasing receptor–G protein–beta-arrestad interactions, the protein can alter downstream second-messenger flux and receptor desensitization.\n\nThe TM2 core and family signature dictate a membrane-resident state. The experimentally supported multi-pass nature and the compact TM2D scaffold point to a stable residence at the cell surface, consistent with GO:0005886 plasma membrane. A plasma-membrane scaffold that binds partners and tunes GPCR outputs is precisely what is required at the signaling interface.\n\nMechanistically, I hypothesize that the protein forms membrane nanodomains that bias GPCR signaling kinetics. The TM2 hairpin promotes oligomerization and lateral association with receptors and G proteins, while cytosolic loops recruit adaptors that control receptor internalization and pathway routing. Likely partners include GPCRs (e.g., adrenergic or chemokine receptors), heterotrimeric G protein subunits, and beta-arrestins. Together, these assemblies provide a tunable platform that modulates receptor responsiveness and downstream signaling amplitude at the plasma membrane.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9BX73.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9BX73"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9BX73/entry","atlas":"/p/Q9BX73"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}