{"uniprot":"Q9BYD5","gene":"CNFN","name":"Cornifelin","organism":"Homo sapiens (Human)","status":"dark","length":112,"sequence":"MSYPVTSQPQCATTSCYQTQLSDWHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIRE","function_summary":"A membrane-associated adaptor that concentrates at the plasma membrane and within cytoplasmic pools of stratified epithelia, where it organizes protein–protein assemblies that tune post-translational modification pathways during terminal differentiation. By anchoring near the cornified envelope, it scaffolds modification and turnover machinery to coordinate maturation of the epithelial barrier, using multivalent binding rather than catalysis to regulate proteostasis at the membrane–envelope interface.","plain_language":"CNFN has barely been studied. The model's best guess: A membrane-associated adaptor that concentrates at the plasma membrane and within cytoplasmic pools of stratified epithelia, where it organizes protein–protein assemblies that tune post-translational modification pathways during terminal differentiation. By anchoring near the cornified envelope, it scaffolds modification and turnover machinery to coordinate maturation of the epithelial barrier, using multivalent binding rather than catalysis to regulate proteostasis at the membrane–envelope interface.","uniprot_summary":"May be involved in differentiation and/or tumorigenesis of stratified epithelial cells.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0036211","label":"protein modification process"}],"cellular_component":[{"id":"GO:0005886","label":"plasma membrane"},{"id":"GO:0001533","label":"cornified envelope"}]},"interpro":[{"id":"IPR006461","name":"PLAC8 motif-containing protein","type":"family","start":20,"end":111}],"reasoning":"I begin with the domain architecture. The sequence contains a single annotated module, IPR006461 (PLAC8 motif-containing protein family) spanning residues 20–111. PLAC8-family proteins are compact, membrane-proximal adaptors that typically form amphipathic helical cores flanked by short hydrophobic segments. This architecture predisposes the polypeptide to embed at or near membranes and to function through multivalent contacts rather than catalysis. The solitary PLAC8 core and the absence of catalytic signatures together argue that the molecule acts as a membrane-associated scaffold that binds other proteins, directly supporting GO:0005515 protein binding as its primary molecular function.\n\nFrom this scaffold-like foundation, I infer the biological role by considering pathway context. PLAC8-family adaptors often tune signaling and trafficking modules that converge on proteostasis. A membrane-tethered binder that organizes local complexes can steer substrate selection and timing for post-translational modification pathways. This causal role—assembly and positioning of machinery that modifies other proteins—aligns with GO:0036211 protein modification process. In epithelial tissues, such scaffolds frequently gate access of substrates to ubiquitin–proteasome and autophagy routes, thereby shaping downstream modification flux.\n\nCellular placement follows from both the PLAC8 membrane-proximal nature and epithelial specialization. The protein is annotated as a single-pass membrane protein and is detected at the cell membrane and in the cytoplasm. In stratified epithelia, membrane-associated scaffolds that participate in terminal differentiation accumulate at the cornified envelope—the insoluble protein shell that defines the barrier layer. This localization is consistent with a membrane-tethered adaptor that helps organize modification and turnover events during terminal differentiation. Thus, I deduce residence at the GO:0005886 plasma membrane and enrichment at the GO:0001533 cornified envelope, with soluble pools in the cytoplasm.\n\nIntegrating these layers yields a mechanistic hypothesis. The PLAC8 core (residues 20–111) anchors the protein at the plasma membrane and within cytoplasmic hubs, where it binds partners to regulate protein modification pathways during epithelial maturation. By clustering ubiquitin–proteasome and autophagy effectors near the cornified envelope, it likely times substrate processing and structural protein assembly. I therefore hypothesize interactions with membrane-proximal proteostasis modules and barrier-layer scaffolds: membrane receptors and transporters that signal differentiation; E3 ubiquitin ligase complexes and proteasome subunits that execute modification; and cornified-envelope constituents that require tightly regulated post-translational remodeling. This arrangement explains how a single-pass, PLAC8-centered adaptor can modulate modification pathways while residing at the membrane–cornified envelope interface.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9BYD5.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9BYD5"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9BYD5/entry","atlas":"/p/Q9BYD5"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}