{"uniprot":"Q9BZA0","gene":"TTTY10","name":"Putative transcript Y 10 protein","organism":"Homo sapiens (Human)","status":"dark","length":68,"sequence":"MKLQTLMDWEEAHEKNRKNKRKAEALVAALQTCRVQDPPGTSTDCYLLPVLKPGHFKKNCPSHKKKPP","function_summary":"A human nuclear regulator that operates in the nucleoplasm as a binding-driven scaffold to repress RNA polymerase II–dependent transcription. By assembling and stabilizing repressive complexes that include chromatin-modifying enzymes, it dampens promoter and enhancer activity and thereby lowers transcriptional output without intrinsic catalytic activity.","plain_language":"TTTY10 has barely been studied. The model's best guess: A human nuclear regulator that operates in the nucleoplasm as a binding-driven scaffold to repress RNA polymerase II–dependent transcription. By assembling and stabilizing repressive complexes that include chromatin-modifying enzymes, it dampens promoter and enhancer activity and thereby lowers transcriptional output without intrinsic catalytic activity.","uniprot_summary":"May be involved in transcriptional regulation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0000122","label":"negative regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated feature: GO:0005515 protein binding as its molecular-function label. With no catalytic domains or recognizable enzymatic cores (e.g., no kinase, nuclease, or acetyltransferase signatures), the most parsimonious architecture is a non-enzymatic, binding-centric regulator. A solitary binding-centric module typically mediates assembly of transcriptional complexes rather than direct catalysis. This architecture causally supports a role as a scaffold or adaptor that modulates other macromolecules through multivalent contacts.\n\nFrom this binding-centric foundation, the molecular function resolves to GO:0005515 protein binding. Such binding capacity is often deployed to repress transcription by stabilizing corepressor assemblies and occluding activator surfaces. This directly motivates the biological process GO:0000122 negative regulation of transcription by RNA polymerase II: a binding-driven repressor can inhibit Pol II output by recruiting histone-modifying enzymes and by constraining coactivator access at promoters and enhancers.\n\nCellular localization follows from function. Repression of Pol II transcription and assembly of chromatin-modifying complexes occur in the soluble nuclear phase rather than membranes or organelles. Thus, the most coherent compartment is the GO:0005654 nucleoplasm, where transcriptional machinery and chromatin regulators congregate. The absence of transmembrane or secretion signals further enforces a soluble nuclear residency.\n\nMechanistically, a binding-only regulator in the nucleoplasm can repress transcription by nucleating repressive assemblies. A plausible model is that this protein binds sequence-specific transcription factors and corepressor systems to dampen Pol II initiation or elongation. By stabilizing complexes that include histone deacetylases and nucleosome remodelers, it would reduce local histone acetylation and increase nucleosome compaction, thereby lowering transcriptional competency. In this framework, likely partners include corepressor scaffolds and chromatin enzymes that operate within the nucleoplasm.\n\nI therefore hypothesize that the protein functions as a nucleoplasmic adaptor that binds transcription factors and corepressor modules to inhibit Pol II-driven gene expression. It likely engages histone deacetylase-containing assemblies and other chromatin regulators to enforce repression at target loci.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9BZA0.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9BZA0"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9BZA0/entry","atlas":"/p/Q9BZA0"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}