{"uniprot":"Q9BZA5","gene":"TXLNGY","name":"Putative gamma-taxilin 2","organism":"Homo sapiens (Human)","status":"dark","length":131,"sequence":"MEEAGLCGLREKADMLCNSESHDILQHQDSNCSATSNKHLLEDEEGRDFITKNRSWVSPVHCTQESRRELPEQEVAPPSGQQALQCNRNKEKVLGKEVLLLMQALNTLSTPEEKLAALCKKYADLGNSPLL","function_summary":"A soluble human adaptor that uses a taxilin-family scaffold to organize regulatory complexes. In the nucleus, it assembles repressive modules that dampen RNA polymerase II–dependent transcription within the nucleoplasm. Outside the nucleus, it associates with cytoskeletal systems, consistent with roles in cell division. Its mechanism relies on multivalent protein binding that stabilizes transcriptional repressors and chromatin regulators in the nucleus while coordinating cytoskeletal assemblies in the cytoplasm.","plain_language":"TXLNGY has barely been studied. The model's best guess: A soluble human adaptor that uses a taxilin-family scaffold to organize regulatory complexes. In the nucleus, it assembles repressive modules that dampen RNA polymerase II–dependent transcription within the nucleoplasm.","uniprot_summary":"May be involved in transcriptional regulation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0000122","label":"negative regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR026183","name":"Taxilin family","type":"family","start":13,"end":126}],"reasoning":"I begin with the InterPro architecture: a single annotated module, IPR026183 (Taxilin family, residues 13–126), occupying essentially the entire polypeptide core. Taxilin-family proteins are compact, acidic adaptors that lack catalytic motifs and instead present low-complexity, coiled-coil–prone surfaces optimized for multivalent protein–protein interactions. The solitary, near-full-length taxilin-family signature indicates a soluble scaffold that organizes regulatory complexes rather than executing enzymatic chemistry. This architecture causally dictates a molecular function centered on protein binding (GO:0005515), with binding surfaces that assemble and modulate transcriptional regulators and cytoskeletal adaptors.\n\nFrom this binding-centric core, I infer two mechanistic axes. First, the nucleoplasmic role: a taxilin-like scaffold can recruit and position transcriptional repressors and chromatin-associated factors to attenuate RNA polymerase II–driven transcription. Such scaffolding provides the physical basis for negative regulation of transcription by RNA polymerase II (GO:0000122), by concentrating repressors and stabilizing repressive assemblies at target loci. Second, the cytoskeletal role: the same binding architecture supports interactions with microtubule- and actin-associated assemblies, explaining how the protein can influence spindle and cortical structures during cell division.\n\nThe cellular context follows directly. The absence of transmembrane segments and the soluble adaptor nature place the protein in the nucleoplasm (GO:0005654), consistent with a nuclear regulatory scaffold. Its experimentally observed cytoplasmic and cytoskeletal associations are mechanistically coherent: a taxilin-family adaptor can shuttle between nucleus and cytoplasm, binding to microtubule- and actin-linked complexes during mitosis and cytokinesis.\n\nThese features together suggest a mechanism: in the nucleus, the taxilin-family core nucleates repressive assemblies that dampen Pol II transcription, likely by tethering transcription factors and chromatin modifiers in the nucleoplasm. In the cytoplasm, the same scaffold binds to cytoskeletal regulators to coordinate cell division machinery. I therefore hypothesize interactions with transcriptional repressors and chromatin regulators in the nucleus, and with cytoskeletal and adaptor proteins outside the nucleus. Candidate partners include nuclear corepressors and Pol II regulators (e.g., NCOR/SMRT complexes, HDAC-containing assemblies) and cytoskeletal systems such as tubulin, dynein–dynactin, and actin-associated adaptors. This dual-network behavior explains how a single taxilin-family scaffold can tune transcription in the nucleoplasm while engaging cytoskeletal frameworks elsewhere.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9BZA5.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9BZA5"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9BZA5/entry","atlas":"/p/Q9BZA5"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}