{"uniprot":"Q9BZK8","gene":"OCR1","name":"Ovarian cancer-related protein 1","organism":"Homo sapiens (Human)","status":"dark","length":76,"sequence":"MPVAPSNHCDNQCPHIFSKALVVSVAPSPPRDKPAPYTFTDVSSLCGLQKKCEGGKAMLFTLKRDRFSFLLFVSHC","function_summary":"A human regulatory scaffold that uses multivalent protein binding to assemble and tune transcriptional complexes. By concentrating co-regulators and polymerase-associated factors within the nucleolus, it modulates RNA polymerase II–dependent transcription, coupling gene-expression programs to nucleolar functions. Its mechanism relies on organizing and stabilizing assemblies rather than direct catalysis or DNA binding, with nucleolar residency governing when and where transcriptional control is exerted.","plain_language":"OCR1 has barely been studied. The model's best guess: A human regulatory scaffold that uses multivalent protein binding to assemble and tune transcriptional complexes. By concentrating co-regulators and polymerase-associated factors within the nucleolus, it modulates RNA polymerase II–dependent transcription, coupling gene-expression programs to nucleolar functions.","uniprot_summary":"May be involved in transcriptional regulation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0006357","label":"regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005730","label":"nucleolus"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding. The presence of a sole, broad binding signature and the absence of catalytic or DNA/RNA-binding motifs indicate a non-enzymatic adaptor or scaffold that organizes other macromolecules. Such architectures typically mediate assembly of transcriptional and chromatin-associated complexes by multivalent contacts rather than direct catalysis.\n\nFrom this binding-centric core, the most direct molecular function is protein binding (GO:0005515). A scaffold that lacks sequence-specific DNA-binding or enzymatic domains usually exerts control by recruiting and stabilizing transcriptional regulators. This causal role—assembly and modulation of regulatory complexes—aligns with regulation of transcription by RNA polymerase II (GO:0006357). By concentrating co-regulators and mediator-like factors, the protein can tune initiation and elongation without directly binding DNA.\n\nCellular localization further constrains mechanism. The nucleolus (GO:0005730) is a central hub for ribosome biogenesis and also serves as a sequestration site for diverse regulatory proteins, including transcriptional modulators and chromatin factors. A nucleolar residency implies that transcriptional control is executed or buffered through nucleolar-associated assemblies. This localization suggests a mechanism in which the protein cycles between nucleolar subdomains and the nucleoplasm to coordinate transcriptional programs with ribosome production demands.\n\nIntegrating these elements yields a coherent mechanism: a nucleolar scaffold that binds multiple partners to regulate RNA polymerase II–dependent transcription. By concentrating transcriptional co-regulators and possibly chromatin remodelers in the nucleolus, it modulates the availability and activity of transcriptional machinery and thereby shapes gene-expression outputs. The hypothesized interaction landscape includes RNA polymerase II–associated factors and nucleolar organizers. Likely partners include mediator and co-regulator assemblies (e.g., Mediator subunits and chromatin remodelers), as well as nucleolar structural proteins such as nucleolin and fibrillarin, which together would anchor and tune transcriptional regulation through nucleolar sequestration and release dynamics.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9BZK8.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9BZK8"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9BZK8/entry","atlas":"/p/Q9BZK8"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}