{"uniprot":"Q9C002","gene":"NMES1","name":"Normal mucosa of esophagus-specific gene 1 protein","organism":"Homo sapiens (Human)","status":"dark","length":83,"sequence":"MSFFQLLMKRKELIPLVVFMTVAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQNVQRVTK","function_summary":"A small, non-catalytic accessory subunit that supports the biogenesis and stability of mitochondrial complex I. It operates as a peripheral membrane scaffold at the inner membrane, using multivalent protein binding to guide and stabilize assembly intermediates and secure steady-state maintenance of the respiratory chain. While essential for complex I function, it does not perform redox chemistry itself; instead, it organizes subunit interfaces and assembly pathways. Its primary activity occurs at the mitochondrial inner membrane, with a minor nuclear-associated pool potentially reflecting transient communication between mitochondrial and nuclear pathways.","plain_language":"NMES1 has barely been studied. The model's best guess: A small, non-catalytic accessory subunit that supports the biogenesis and stability of mitochondrial complex I. It operates as a peripheral membrane scaffold at the inner membrane, using multivalent protein binding to guide and stabilize assembly intermediates and secure steady-state maintenance of the respiratory chain.","uniprot_summary":"Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0032981","label":"mitochondrial respiratory chain complex I assembly"}],"cellular_component":[{"id":"GO:0005634","label":"nucleus"}]},"interpro":[{"id":"IPR010530","name":"NADH-ubiquinone reductase complex 1 MLRQ subunit","type":"family","start":1,"end":83}],"reasoning":"I begin with the InterPro architecture: IPR010530 (NADH-ubiquinone reductase complex 1 MLRQ subunit family) spans residues 1–83 and covers essentially the entire polypeptide. This family signature defines a small, basic accessory subunit of mitochondrial complex I that lacks catalytic motifs but is conserved for assembly and structural stabilization. The compact size and single family domain imply a non-enzymatic role that operates through specific protein–protein interfaces rather than chemistry, which causally supports a primary molecular function of protein binding (GO:0005515).\n\nA dedicated assembly/stability module of this class naturally drives mitochondrial respiratory chain complex I assembly (GO:0032981). By stabilizing interfaces among complex I modules and guiding intermediate assembly states, it ensures the proper incorporation of catalytic cores while remaining peripherally associated. This assembly role explains why the protein is essential for complex I function yet not directly catalytic: its binding-driven scaffolding and checkpoint activity cause the maturation and maintenance of the holoenzyme.\n\nCellular localization follows from function and architecture. The assembly/stability role for complex I places the protein at the mitochondrial inner membrane system, consistent with a peripheral membrane protein that associates with the membrane arm of complex I. Thus, the most parsimonious cellular component is the mitochondrial inner membrane environment and the complex I particle itself. A reported nuclear association (GO:0005634 nucleus) suggests a secondary pool that could participate in mitochondrial–nuclear communication or transient trafficking; however, the mechanistic core of its activity occurs at the inner membrane-bound complex I assembly platform.\n\nMechanistically, the protein likely binds multiple complex I subunits and assembly factors to nucleate and stabilize assembly intermediates. By forming a small, rigid binding hub, it reduces the energetic barrier for subunit docking and helps couple membrane-proximal assembly to the maturation of electron-transfer modules. I hypothesize that it transiently associates with core and accessory complex I subunits and with assembly chaperones to coordinate stepwise assembly, ensuring efficient biogenesis and steady-state maintenance of complex I.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9C002.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9C002"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9C002/entry","atlas":"/p/Q9C002"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}