{"uniprot":"Q9H0P7","gene":"AGPAT4-IT1","name":"Putative uncharacterized protein encoded by AGPAT4-IT1","organism":"Homo sapiens (Human)","status":"dark","length":198,"sequence":"MADTQCCPPPCEFISSAGTDLALGMGWDATLCLLPFTGFGKCAGIWNHMDEEPDNGDDRGSRRTTGQGRKWAAHGTMAAPRVHTDYHPGGGSACSSVKVRSHVGHTGVFFFVDQDPLAVSLTSQSLIPPLIKPGLLKAWGFLLLCAQPSANGHSLCCLLYTDLVSSHELSPFRALCLGPSDAPSACASCNCLASTYYL","function_summary":"A human nuclear scaffold that concentrates in the nucleoplasm and associates with the nuclear envelope, where it organizes protein assemblies that regulate gene programs underlying bone formation and remodeling. By using multivalent binding to recruit transcriptional and chromatin-associated factors at the nuclear periphery, it modulates osteogenic pathways and coordinates nuclear architecture with lineage-specific transcription during bone development.","plain_language":"AGPAT4-IT1 has barely been studied. The model's best guess: A human nuclear scaffold that concentrates in the nucleoplasm and associates with the nuclear envelope, where it organizes protein assemblies that regulate gene programs underlying bone formation and remodeling. By using multivalent binding to recruit transcriptional and chromatin-associated factors at the nuclear periphery, it modulates osteogenic pathways and coordinates nuclear architecture with lineage-specific transcription during bone development.","uniprot_summary":"Involved in bone development.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0060348","label":"bone development"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"},{"id":"GO:0031965","label":"nuclear membrane"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated feature: GO:0005515 protein binding as a core capability. The absence of catalytic InterPro domains and the prominence of a binding-centric annotation indicate a non-enzymatic scaffold or adaptor. The cellular geography—association with the nuclear membrane and nucleoplasm—implies a soluble, likely nucleoplasmic protein that can dock at the nuclear envelope. This spatial arrangement typically arises in inner nuclear membrane–anchored complexes that regulate gene expression and nuclear architecture.\n\nFrom this binding-centric architecture, the most direct molecular function is protein binding (GO:0005515). A binding scaffold situated at the nuclear periphery can assemble transcriptional regulators and chromatin-associated factors. Such assemblies causally influence lineage-specific transcriptional programs. The explicit linkage to bone development suggests that the scaffold modulates gene networks controlling osteoblast and osteoclast pathways. This mechanistically supports the biological process of GO:0060348 bone development: by organizing regulatory complexes at or near the nuclear envelope, the protein can tune expression of osteogenic and osteolytic genes.\n\nThe cellular component terms align with this model. Localization to the nucleoplasm (GO:0005654) provides a soluble reservoir for dynamic assembly, while association with the nuclear membrane (GO:0031965) positions the protein at the inner nuclear membrane where transcriptional and structural hubs form. This dual localization enables responsive shuttling between membrane-proximal platforms and nucleoplasmic chromatin, consistent with a regulatory scaffold rather than a membrane transporter or enzyme.\n\nPutting these elements together, I infer a mechanism in which the protein acts as a nuclear scaffold that binds partners to regulate osteogenic transcriptional programs. It likely interacts with inner nuclear membrane proteins and chromatin regulators to stabilize or repress target loci controlling bone formation and remodeling. Candidate partners include lamina and inner nuclear membrane constituents that recruit transcriptional machinery, as well as lineage-specific transcription factors central to osteogenesis. Through these assemblies, the protein couples nuclear architecture to bone development pathways.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9H0P7.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9H0P7"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9H0P7/entry","atlas":"/p/Q9H0P7"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}