{"uniprot":"Q9H1A7","gene":"POLR2J3","name":"DNA-directed RNA polymerase II subunit RPB11-b2","organism":"Homo sapiens (Human)","status":"dark","length":115,"sequence":"MNAPPAFESFLLFEGEKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP","function_summary":"A small, soluble nuclear subunit of the human transcription machinery that structurally organizes the core of the RNA-synthesizing enzyme responsible for mRNA precursor and non-coding RNA production. It achieves this by forming a tight dimeric interface that nucleates assembly of the polymerase core and stabilizes its geometry for promoter engagement and elongation. Operating within the nucleoplasm as part of the core enzyme, it supports assembly and function of the nuclear transcription apparatus rather than catalyzing polymerization itself.","plain_language":"POLR2J3 has barely been studied. The model's best guess: A small, soluble nuclear subunit of the human transcription machinery that structurally organizes the core of the RNA-synthesizing enzyme responsible for mRNA precursor and non-coding RNA production. It achieves this by forming a tight dimeric interface that nucleates assembly of the polymerase core and stabilizes its geometry for promoter engagement and elongation.","uniprot_summary":"DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. Involved in regulation of transcription.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0006366","label":"transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"},{"id":"GO:0005665","label":"RNA polymerase II, core complex"}]},"interpro":[{"id":"IPR036603","name":"RNA polymerase, RBP11-like subunit","type":"homologous_superfamily","start":1,"end":109},{"id":"IPR009025","name":"DNA-directed RNA polymerase, RBP11-like dimerisation domain","type":"domain","start":30,"end":102},{"id":"IPR037685","name":"RNA polymerase RBP11","type":"family","start":14,"end":104},{"id":"IPR022905","name":"DNA-directed RNA polymerase subunit Rpo11-like","type":"family","start":22,"end":104},{"id":"IPR008193","name":"DNA-directed RNA polymerase Rpb11, 13-16kDa subunit, conserved site","type":"conserved_site","start":34,"end":65}],"reasoning":"I begin with the InterPro architecture. The polypeptide is fully encompassed by IPR036603 (RNA polymerase, RBP11-like subunit homologous superfamily, residues 1–109), establishing membership in the conserved small subunit class that forms part of eukaryotic and archaeal RNA polymerases. Within this scaffold, IPR009025 (DNA-directed RNA polymerase, RBP11-like dimerisation domain, residues 30–102) defines a central structural module that enforces obligate dimerization—classically with the Rpb3-like partner—to nucleate assembly of the polymerase core. This dimerization core is reinforced by multiple family-level signatures: IPR037685 (RNA polymerase RBP11 family, residues 14–104) and IPR022905 (DNA-directed RNA polymerase subunit Rpo11-like family, residues 22–104), which together specify the subunit’s identity and its role in the multi-subunit enzyme. A conserved functional hotspot is highlighted by IPR008193 (Rpb11 13–16 kDa subunit conserved site, residues 34–65), indicating residues that stabilize the dimer interface and couple to the larger assembly. The ordered layout—global RBP11-like fold (1–109), a central dimerization domain (30–102), and a conserved interaction site (34–65)—causes robust protein–protein assembly behavior rather than catalysis.\n\nFrom this architecture, the molecular function resolves as protein binding (GO:0005515). The RBP11-like fold lacks catalytic motifs for nucleotide polymerization but presents a hydrophobic, helical interface that drives heterotypic dimerization and higher-order assembly. This binding capacity is not generic; it is structurally tuned to form a stable heterodimer that seeds the core of the polymerase and positions other subunits.\n\nThis binding-driven assembly role directly supports transcription by RNA polymerase II (GO:0006366). By stabilizing the core enzyme that synthesizes mRNA precursors and diverse non-coding RNAs, the subunit sustains the transcriptional apparatus that orchestrates gene expression. The dimerization domain ensures that the polymerase core adopts the correct geometry for promoter engagement and elongation, thereby causally enabling Pol II–dependent transcription.\n\nCellular localization follows from function and assembly context. The subunit integrates into the RNA polymerase II core complex (GO:0005665), which operates in the nucleoplasm (GO:0005654). The absence of transmembrane features and the presence of nuclear transcriptional machinery point to a soluble nuclear complex that assembles and functions within chromatin-rich nucleoplasmic compartments.\n\nMechanistically, the protein acts as a structural linchpin. Its RBP11-like dimerization domain forms a tight heterodimer that organizes the core scaffold; this nucleates recruitment of additional subunits and interfaces with initiation and elongation factors. I therefore hypothesize preferential interactions with the Rpb3-like partner to form the seed heterodimer, with adjacent core subunits that stabilize the clamp and stalk, and with initiation assemblies that dock onto the assembled core. Through these contacts, the subunit indirectly governs polymerase assembly, promoter engagement, and transcript production in the nuclear environment.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9H1A7.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9H1A7"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9H1A7/entry","atlas":"/p/Q9H1A7"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}