{"uniprot":"Q9H4R4","gene":"NCOR1P1","name":"Putative nuclear receptor corepressor 1-like protein NCOR1P1","organism":"Homo sapiens (Human)","status":"dark","length":102,"sequence":"MSSSGYPPNQGAFSTEQSHYPPHSVKYTFPSTHHQQDPAFGGKHEAPSSPILGQPCGDDQNASPSKLSKEELIECMDRVDREIAKVEQQILKLKKKQVKVFV","function_summary":"A nuclear corepressor that assembles oligomeric repression platforms to control RNA polymerase II–dependent transcription. It uses an N-terminal interaction hub to bind transcription factors and recruit chromatin-modifying enzymes, thereby silencing nuclear receptor targets and other genes. Through context-dependent assemblies, it can also enhance transcription indirectly by stabilizing pathway-specific complexes, including those that promote canonical Wnt signaling. The complex operates primarily in the nucleoplasm with exchangeable cytosolic pools and functions by coupling factor recognition to histone deacetylase–linked repression.","plain_language":"NCOR1P1 has barely been studied. The model's best guess: A nuclear corepressor that assembles oligomeric repression platforms to control RNA polymerase II–dependent transcription. It uses an N-terminal interaction hub to bind transcription factors and recruit chromatin-modifying enzymes, thereby silencing nuclear receptor targets and other genes.","uniprot_summary":"Acts as a nuclear receptor corepressor.","go_terms":{"molecular_function":[{"id":"GO:0042802","label":"identical protein binding"},{"id":"GO:0019904","label":"protein domain specific binding"},{"id":"GO:0003714","label":"transcription corepressor activity"},{"id":"GO:0140297","label":"DNA-binding transcription factor binding"}],"biological_process":[{"id":"GO:0030177","label":"positive regulation of canonical Wnt signaling pathway"},{"id":"GO:0006357","label":"regulation of transcription by RNA polymerase II"},{"id":"GO:0045935","label":"positive regulation of nucleic acid-templated transcription"},{"id":"GO:0045944","label":"positive regulation of transcription by RNA polymerase II"},{"id":"GO:0000122","label":"negative regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR031557","name":"N-CoR, GPS2-interacting domain","type":"domain","start":41,"end":98},{"id":"IPR051571","name":"Nuclear receptor corepressor","type":"family","start":35,"end":97}],"reasoning":"I begin with the InterPro architecture. Two overlapping N-terminal modules dominate: IPR051571 (Nuclear receptor corepressor family, residues 35–97) and IPR031557 (N-CoR, GPS2-interacting domain, residues 41–98). Their tight colocalization creates a compact interaction hub that nucleates corepressor assemblies. The N-CoR family signature (IPR051571) specifies a scaffold that binds transcription factors and chromatin-modifying enzymes to silence transcription. The embedded GPS2-interacting domain (IPR031557) provides a docking site for GPS2, a canonical subunit of histone deacetylase–containing complexes, thereby coupling the corepressor to deacetylase machinery and chromatin. This architecture causes transcriptional repression by physically tethering nuclear receptors and other DNA-bound factors to HDAC-containing complexes and by stabilizing higher-order oligomers.\n\nFrom this scaffold, the molecular functions follow. The corepressor module inherently mediates GO:0003714 transcription corepressor activity by recruiting and organizing repressive chromatin-modifying enzymes. Its oligomeric nature and conserved interfaces rationalize GO:0042802 identical protein binding through self-association that strengthens repression platforms. The same surfaces and the GPS2-binding core explain GO:0019904 protein domain specific binding, because the complex recognizes defined domains on transcription factors and co-regulators. The ability to engage DNA-binding transcription factors through short linear motifs and structured interfaces supports GO:0140297 DNA-binding transcription factor binding.\n\nThese molecular activities propagate to biological processes. By assembling HDAC-linked repression modules, the protein enforces GO:0000122 negative regulation of transcription by RNA polymerase II at target promoters and enhancers. Context-dependent assembly with pathway-specific transcription factors can also yield net transcriptional enhancement—particularly when repression of antagonists or enhancer switching transiently boosts pathway output—accounting for GO:0045944 positive regulation of transcription by RNA polymerase II. The same corepressor scaffold can potentiate GO:0090263 positive regulation of canonical Wnt signaling pathway by stabilizing Wnt-responsive transcriptional assemblies and by relieving repression at Wnt target loci.\n\nCellular localization is dictated by function and composition. The absence of transmembrane features and the presence of chromatin-interacting modules place the complex in the nucleus, specifically the GO:0005654 nucleoplasm where transcriptional regulation occurs. Dynamic exchange with soluble pools and assembly pathways explains detection in the GO:0005829 cytosol, consistent with nucleocytoplasmic shuttling of corepressor complexes.\n\nMechanistically, the N-terminal N-CoR/GPS2-interacting hub seeds a higher-order assembly that binds identical subunits and recruits transcription factors and chromatin modifiers. This assembly represses nuclear receptor targets and other RNA polymerase II–regulated genes by positioning deacetylase activity and stabilizing closed chromatin. In signaling contexts such as Wnt, the same scaffold can transiently enhance pathway output by focusing repression onto inhibitory nodes or by forming selective enhancer-bound complexes. I therefore hypothesize interactions with nuclear receptors and sequence-specific transcription factors, with GPS2 and associated deacetylase assemblies, and with pathway-specific partners that tune repression-versus-activation outcomes in the nucleoplasm and at shuttling cytosolic pools.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9H4R4.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9H4R4"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9H4R4/entry","atlas":"/p/Q9H4R4"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}