{"uniprot":"Q9H596","gene":"DUSP21","name":"Dual specificity protein phosphatase 21","organism":"Homo sapiens (Human)","status":"dark","length":190,"sequence":"MTASASSFSSSQGVQQPSIYSFSQITRSLFLSNGVAANDKLLLSSNRITAIVNASVEVVNVFFEGIQYIKVPVTDARDSRLYDFFDPIADLIHTIDMRQGRTLLHCMAGVSRSASLCLAYLMKYHSMSLLDAHTWTKSRRPIIRPNNGFWEQLINYEFKLFNNNTVRMINSPVGNIPDIYEKDLRMMISM","function_summary":"A soluble human dual-specificity phosphatase that uses a cysteine-dependent catalytic center to remove phosphate groups from intracellular signaling proteins. It displays phosphatase activity toward MAPK1 and MAPK3 in vitro, yet is proposed to act predominantly on serine/threonine-phosphorylated targets in vivo, indicating a role in tuning kinase cascades beyond classical tyrosine signaling. Operating across cytoplasm and nucleus, it likely modulates ERK pathway flux and other phosphorylation-dependent programs by transiently binding substrates and resetting their signaling states.","plain_language":"DUSP21 has barely been studied. The model's best guess: A soluble human dual-specificity phosphatase that uses a cysteine-dependent catalytic center to remove phosphate groups from intracellular signaling proteins. It displays phosphatase activity toward MAPK1 and MAPK3 in vitro, yet is proposed to act predominantly on serine/threonine-phosphorylated targets in vivo, indicating a role in tuning kinase cascades beyond classical tyrosine signaling.","uniprot_summary":"Shows phosphatase activity towards MAPK1 and MAPK3 (in vitro), but is probably involved in the dephosphorylation of proteins phosphorylated on Ser/Thr residues, rather than Tyr residues, in vivo.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"},{"id":"GO:0004725","label":"protein tyrosine phosphatase activity"}],"biological_process":[{"id":"GO:0035335","label":"peptidyl-tyrosine dephosphorylation"}],"cellular_component":[{"id":"GO:0005737","label":"cytoplasm"},{"id":"GO:0005634","label":"nucleus"}]},"interpro":[{"id":"IPR029021","name":"Protein-tyrosine phosphatase-like","type":"homologous_superfamily","start":11,"end":190},{"id":"IPR020422","name":"Dual specificity protein phosphatase domain","type":"domain","start":21,"end":162},{"id":"IPR000340","name":"Dual specificity phosphatase, catalytic domain","type":"domain","start":29,"end":157},{"id":"IPR000387","name":"Tyrosine-specific protein phosphatases domain","type":"domain","start":82,"end":141},{"id":"IPR020420","name":"Atypical dual specificity phosphatase, subfamily B","type":"family","start":24,"end":40},{"id":"IPR020420","name":"Atypical dual specificity phosphatase, subfamily B","type":"family","start":43,"end":57},{"id":"IPR020420","name":"Atypical dual specificity phosphatase, subfamily B","type":"family","start":68,"end":77},{"id":"IPR020420","name":"Atypical dual specificity phosphatase, subfamily B","type":"family","start":84,"end":98},{"id":"IPR016130","name":"Protein-tyrosine phosphatase, active site","type":"active_site","start":104,"end":114}],"reasoning":"I begin with the InterPro architecture. The core scaffold is IPR029021 (Protein-tyrosine phosphatase-like homologous superfamily, residues 11–190), which frames a classical PTP fold. Nested within it are two catalytic signatures that define a dual-specificity phosphatase (DSP) core: IPR020422 (Dual specificity protein phosphatase domain, residues 21–162) and IPR000340 (Dual specificity phosphatase, catalytic domain, residues 29–157). The presence of IPR000387 (Tyrosine-specific protein phosphatases domain, residues 82–141) indicates retention of the canonical PTPase architecture that can hydrolyze phosphomonoesters on both phosphotyrosine and phosphoserine/threonine substrates. The catalytic nucleophile is pinpointed by IPR016130 (Protein-tyrosine phosphatase, active site, residues 104–114), which marks the HC(X)5R motif that forms the cysteinyl-phosphate intermediate and drives hydrolysis. Three additional family-level annotations—IPR020420 (Atypical dual specificity phosphatase, subfamily B, residues 24–40, 43–57, 68–77, and 84–98)—map to conserved subfamily B features that tune substrate preference and regulation rather than providing classical MAPK-directed docking modules. The ordered layout—PTP-like superfamily envelope, DSP catalytic core, embedded PTP catalytic region, and subfamily B determinants—causally establishes a soluble, cysteine-dependent phosphatase with dual-specificity chemistry.\n\nThis catalytic architecture dictates molecular function. The HC(X)5R active site and DSP domains cause phosphoprotein hydrolysis consistent with GO:0004725 protein tyrosine phosphatase activity and, by virtue of DSP hallmarks, broader phosphoserine/threonine capability. The absence of transmembrane segments and the soluble fold support a non-membranous enzyme that engages targets through transient interfaces, aligning with GO:0005515 protein binding as an enabling function for substrate capture and regulatory interactions.\n\nFrom function to process, a DSP that removes phosphate groups from intracellular signaling proteins directly drives GO:0035335 peptidyl-tyrosine dephosphorylation. The atypical subfamily B context and reported substrate preferences (MAPK1/ERK2 and MAPK3/ERK1 in vitro; preference for phosphotyrosine in vitro but in vivo bias toward phosphoserine/threonine) indicate it modulates kinase pathways by tuning both tyrosine and serine/threonine phosphorylation states within signaling cascades.\n\nCellular location follows from solubility and regulatory role. The lack of signal peptides and membrane anchors, together with the need to access cytosolic kinase pathways and nuclear transcriptional programs, supports a dual soluble distribution between GO:0005737 cytoplasm and GO:0005634 nucleus. Such nucleo-cytoplasmic shuttling is typical for DSPs that gate MAPK and stress-response circuits.\n\nMechanistically, the enzyme likely cycles between reduced and oxidized cysteine states to regulate activity, with subfamily B features biasing target selection. In vitro activity toward MAPK1 and MAPK3 suggests transient engagement with ERK pathways; however, the in vivo bias toward serine/threonine implies it primarily resets phospho-Ser/Thr-driven signaling nodes and adaptor complexes. I hypothesize it binds MAPKs via shallow hydrophobic grooves near the DSP core and uses local electrostatics to orient the phosphate for nucleophilic attack. Likely interaction partners include ERK1/2, upstream RAF-MEK scaffolds, and nuclear transcriptional regulators downstream of MAPK signaling. This ensemble of interactions positions the enzyme as a soluble regulator that fine-tunes phosphorylation flux across cytoplasmic and nuclear compartments.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9H596.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9H596"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9H596/entry","atlas":"/p/Q9H596"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}