{"uniprot":"Q9H606","gene":"PRORY","name":"Proline-rich protein, Y-linked","organism":"Homo sapiens (Human)","status":"dark","length":182,"sequence":"MMRRSPSGLKSPRVSQGRKPRDPESLLFLRCCLGSEPHNLSSLLSPEAGQEPLPKLLPQPLAGHAAWGIHGVPTSLLLAGECWGQGMAVPADPPPASPYRTSPRPPPGPLPRYRPQQHLLLPLGRLHALCPGCPLQQSLQFERGTLSAPRLWSWMKLETIILSKLSQGQKTKHRMFSLISES","function_summary":"A human nucleoplasmic adaptor that relies on multivalent protein binding to organize regulatory complexes during male germ cell development. By scaffolding partners within the nucleus, it likely coordinates transcriptional and chromatin-remodeling pathways that drive spermatogenesis forward, acting as a non-enzymatic organizer of nucleoplasmic assemblies that tune germ cell progression.","plain_language":"PRORY has barely been studied. The model's best guess: A human nucleoplasmic adaptor that relies on multivalent protein binding to organize regulatory complexes during male germ cell development. By scaffolding partners within the nucleus, it likely coordinates transcriptional and chromatin-remodeling pathways that drive spermatogenesis forward, acting as a non-enzymatic organizer of nucleoplasmic assemblies that tune germ cell progression.","uniprot_summary":"May be involved in spermatogenesis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0007283","label":"spermatogenesis"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding as a basal molecular function. The absence of catalytic InterPro signatures and the prominence of a generic binding annotation indicate a non-enzymatic scaffold/adaptor whose primary role is mediated by multivalent protein–protein interactions. Such binding-centric architectures typically stabilize transient assemblies and regulate signaling or transcriptional pathways rather than catalyzing reactions.\n\nFrom this binding-centric core, I infer the biological role by considering the specialized context of germ cell development. The explicit linkage to GO:0007283 spermatogenesis situates the protein within the male germline program. Binding-driven scaffolds in this pathway often coordinate chromatin state transitions and checkpoint signaling that underpin meiosis and spermiogenesis. The architecture therefore causes a regulatory function: assembling and tuning nuclear complexes that drive spermatogenic progression.\n\nCellular localization follows from the functional logic. The presence of a binding scaffold that modulates germ cell programs and the stated nuclear role point to a soluble nuclear pool. This aligns with GO:0005654 nucleoplasm, where such assemblies control gene expression and chromatin dynamics. A nucleoplasmic scaffold can shuttle among chromatin-associated foci and nuclear bodies, consistent with a dynamic regulatory role rather than stable membrane attachment.\n\nMechanistically, I hypothesize that the protein operates as a nucleoplasmic adaptor that binds multiple partners to coordinate spermatogenic signaling. By concentrating regulatory factors, it likely influences transcriptional and chromatin-remodeling modules that time meiotic entry and differentiation. Candidate partners include germline-enriched chromatin regulators and nuclear transport adaptors that together choreograph nucleoplasmic assemblies during spermatogenesis.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9H606.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9H606"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9H606/entry","atlas":"/p/Q9H606"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}