{"uniprot":"Q9HBX3","gene":"SND1-IT1","name":"Uncharacterized protein encoded by SND1-IT1","organism":"Homo sapiens (Human)","status":"dark","length":110,"sequence":"MSHHPHSLRNSCLIRMDLLYWQFTIYTITFCFSHLSGRLTLSAQHISHRPCLLSYSLLFWKVHHLFLEGFPCSPRLDEMSFHQFPQHPVHVSVVHLPIVYKGSMTQVSPH","function_summary":"A soluble mitochondrial factor that binds other proteins to assemble and stabilize mitochondrial ribonucleoprotein complexes, thereby prolonging the lifetime of organellar transcripts and coordinating their delivery to the mitoribosome. By scaffolding RNA-protective assemblies, it biases mitochondrial mRNA toward stabilization and translation within the organelle’s RNA–protein network.","plain_language":"SND1-IT1 has barely been studied. The model's best guess: A soluble mitochondrial factor that binds other proteins to assemble and stabilize mitochondrial ribonucleoprotein complexes, thereby prolonging the lifetime of organellar transcripts and coordinating their delivery to the mitoribosome. By scaffolding RNA-protective assemblies, it biases mitochondrial mRNA toward stabilization and translation within the organelle’s RNA–protein network.","uniprot_summary":"May be involved in RNA stabilization.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0043489","label":"RNA stabilization"},{"id":"GO:0048255","label":"mRNA stabilization"}],"cellular_component":[{"id":"GO:0005739","label":"mitochondrion"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. Although no specific domains are annotated here, the functional profile and localization together imply a soluble RNA/protein-interacting factor rather than a membrane enzyme. The presence of GO:0005515 protein binding as the defining molecular function indicates a scaffold or adaptor that organizes ribonucleoprotein assemblies. The biological process labels—GO:0048255 mRNA stabilization and GO:0043489 RNA stabilization—tie this binding capacity to a role in preserving transcript integrity and tuning decay pathways. The cellular component label GO:0005739 mitochondrion places this activity in the mitochondrial compartment, where RNA handling is compartmentalized despite mitochondria using bacterial-type ribosomes.\n\nFrom this domain-informed baseline, I infer function and mechanism. A soluble mitochondrial factor that binds proteins and stabilizes RNA will act by assembling or remodeling messenger ribonucleoprotein complexes that govern transcript protection and translation. In mitochondria, mRNA stability is governed by RNA chaperones and decay modulators; a binding-competent scaffold can shield 5′/3′ ends, recruit protective factors, and bias the balance between translation and decay. This causal chain—from RNA stabilization to mRNA stabilization—grounds the molecular function as protein binding and explains how the protein enforces transcript fidelity within the organelle.\n\nThe cellular location follows directly. Mitochondrial RNA metabolism occurs in matrix-proximal assemblies and is coordinated with the organelle’s translation system. A soluble, non-enzymatic binder that stabilizes RNA in this context is best placed in the mitochondrial compartment (GO:0005739 mitochondrion), where it can interface with mitochondrial ribosomes and RNA-processing hubs.\n\nThis architecture and localization suggest a mechanism: the protein nucleates or joins mitochondrial mRNPs to prolong transcript half-lives and coordinate their delivery to the mitoribosome. By transiently engaging RNA-binding and decay factors, it likely buffers transcripts against exonucleolytic attack and promotes efficient handoff to the translational machinery. Consequently, I hypothesize interactions with mitochondrial RNA-binding and stabilization factors (such as LRPPRC and NAF1), decay and surveillance components (the SUV3–PNPT1 pathway), and mitoribosomal proteins that receive stabilized messages. These partnerships would collectively tune RNA fate and ensure that stabilized mitochondrial mRNAs are preferentially translated in situ.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9HBX3.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9HBX3"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9HBX3/entry","atlas":"/p/Q9HBX3"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}