{"uniprot":"Q9NQ34","gene":"TMEM9B","name":"Transmembrane protein 9B","organism":"Homo sapiens (Human)","status":"dark","length":198,"sequence":"MATLWGGLLRLGSLLSLSCLALSVLLLAQLSDAAKNFEDVRCKCICPPYKENSGHIYNKNISQKDCDCLHVVEPMPVRGPDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS","function_summary":"A human multi-pass membrane scaffold that promotes assembly of signaling complexes controlling NF-kappa-B activation. By anchoring and organizing adaptor and receptor modules on intracellular membranes, it enhances pathway throughput and transcriptional outputs. Its dynamic redistribution to spindle and intercellular bridge structures suggests coordinated control of signaling with cell-cycle and cytokinesis machinery, achieved through multivalent protein binding rather than direct catalysis.","plain_language":"TMEM9B has barely been studied. The model's best guess: A human multi-pass membrane scaffold that promotes assembly of signaling complexes controlling NF-kappa-B activation. By anchoring and organizing adaptor and receptor modules on intracellular membranes, it enhances pathway throughput and transcriptional outputs.","uniprot_summary":"May be involved in NF-kappa-B signaling.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0043123","label":"positive regulation of I-kappaB kinase/NF-kappaB signaling"}],"cellular_component":[{"id":"GO:0045171","label":"intercellular bridge"},{"id":"GO:0043231","label":"intracellular membrane-bounded organelle"},{"id":"GO:0072686","label":"mitotic spindle"}]},"interpro":[{"id":"IPR008853","name":"TMEM9/TMEM9B","type":"family","start":9,"end":198}],"reasoning":"I begin with the InterPro architecture: IPR008853 (TMEM9/TMEM9B family) spans residues 9–198, essentially covering the full-length polypeptide. This family signature denotes a small, multi-pass membrane protein architecture that lacks catalytic motifs and instead specializes in membrane-embedded scaffolding and signaling modulation. The continuous family coverage and absence of soluble enzymatic domains argue that function emerges from membrane anchoring and protein–protein interactions rather than direct catalysis, which causally supports a primary molecular role in protein binding (GO:0005515).\n\nA membrane-tethered scaffold of this class typically organizes signaling assemblies at endomembranes and the cell surface. In this case, the TMEM9/TMEM9B family architecture is well-suited to nucleate complexes that potentiate the IκB kinase cascade, thereby driving NF-κB pathway activation. Such scaffolding and adaptor roles provide a mechanistic route to positive regulation of I-kappaB kinase/NF-kappaB signaling (GO:0043123): by clustering upstream receptors and adaptors, the membrane core increases local reaction flux toward IKK activation and downstream transcriptional responses.\n\nCellular localization further constrains mechanism. The protein is a multi-pass membrane component and is observed at intracellular membrane-bounded organelles (GO:0043231), consistent with endoplasmic reticulum, Golgi, or endosomal systems where NF-κB signaling complexes assemble. Its presence at the intercellular bridge (GO:0045171) and mitotic spindle (GO:0072686) indicates cell-cycle-coupled redistribution—likely via cytoskeleton-guided trafficking that coordinates cytokinesis and checkpoint signaling. This dynamic itinerary explains how a membrane scaffold can transiently interface with cytoskeletal structures and bridge structures to synchronize signaling with mitotic progression.\n\nIntegrating these observations, I infer that the TMEM9/TMEM9B membrane architecture causes assembly and stabilization of signaling and cytoskeletal modules through multivalent protein binding. This yields a mechanistic model: a multi-pass membrane scaffold that enhances NF-κB pathway throughput by recruiting IKK-proximal adaptors on endomembranes, with regulated relocalization to spindle and intercellular bridge structures during mitosis. Likely interaction partners include IKK complex components and adaptors (to enact NF-κB activation), as well as cytoskeletal and cytokinesis machinery that guide its trafficking and function.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9NQ34.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9NQ34"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9NQ34/entry","atlas":"/p/Q9NQ34"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}