{"uniprot":"Q9NQG1","gene":"MANBAL","name":"Protein MANBAL","organism":"Homo sapiens (Human)","status":"dark","length":85,"sequence":"MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAVPSVNKRPKKETKKKR","function_summary":"A small human membrane-tethered adaptor that assembles protein complexes at the endoplasmic reticulum. By using a single-pass topology to anchor transient interaction hubs, it binds other proteins and tunes the activity of phosphatase pathways by positioning enzymes and substrates at ER-associated signaling sites. This spatial regulation provides a mechanism to modulate phosphorylation states without intrinsic catalysis, consistent with a role in organizing membrane-proximal signaling assemblies.","plain_language":"MANBAL has barely been studied. The model's best guess: A small human membrane-tethered adaptor that assembles protein complexes at the endoplasmic reticulum. By using a single-pass topology to anchor transient interaction hubs, it binds other proteins and tunes the activity of phosphatase pathways by positioning enzymes and substrates at ER-associated signaling sites.","uniprot_summary":"May be involved in biological processes.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0043666","label":"regulation of phosphoprotein phosphatase activity"}],"cellular_component":[{"id":"GO:0005783","label":"endoplasmic reticulum"}]},"interpro":[{"id":"IPR009621","name":"Uncharacterised protein family UPF0239","type":"family","start":1,"end":85}],"reasoning":"I begin with the InterPro architecture: IPR009621 (Uncharacterised protein family UPF0239, residues 1–85) spans essentially the entire polypeptide, indicating a compact, single-module membrane protein. UPF0239 family members are typically small, hydrophobic, and often form single-pass or short multi-pass topologies that act as membrane-tethered adaptors rather than soluble enzymes. The full-length coverage of a single uncharacterized family signature, together with the experimentally observed single-pass membrane behavior, argues for a non-catalytic scaffold that mediates protein–protein interactions at a membrane surface.\n\nThis architecture causally supports a binding-centric molecular function. The absence of catalytic motifs and the precedent of small membrane adaptors point to GO:0005515 protein binding as the operative activity. A single-pass topology anchored in a membrane favors assembly of transient complexes by presenting a cytosolic or luminal tail for partner engagement.\n\nFrom this binding role, I infer the biological process by considering how a membrane-tethered adaptor could influence signaling. The explicit linkage to phosphatase pathway control is captured by GO:0043666 regulation of phosphoprotein phosphatase activity. A membrane-resident scaffold can regulate phosphatases by recruiting them to specific subcellular locales, altering their access to substrates, or stabilizing active/inactive conformations. The UPF0239 family’s membrane anchoring provides the spatial logic for such regulation.\n\nCellular localization follows from both topology and function. The experimentally supported membrane insertion and the GO:0005783 endoplasmic reticulum label converge into a coherent picture: an ER-associated single-pass adaptor that organizes signaling assemblies at the ER interface. The ER is a central hub for secretory pathway control and for the assembly and trafficking of receptors and enzymes that modulate phosphorylation states. Thus, ER association explains how this protein can tune phosphatase activity by positioning those enzymes and their substrates.\n\nMechanistically, I hypothesize that the UPF0239 module forms a stable ER-anchored platform that binds cytosolic phosphatase regulators and receptor-proximal signaling factors. By concentrating serine/threonine phosphatases or their adaptors at ER–plasma membrane contact sites or ER-associated endocytic/exocytic platforms, it modulates local dephosphorylation flux. Likely partners include ER-resident adaptors and chaperones that stabilize membrane complexes, as well as phosphatase pathway components whose activity is tuned by localization. This arrangement yields a membrane-tethered regulatory node that adjusts phosphoprotein phosphatase activity without intrinsic catalysis.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9NQG1.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9NQG1"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9NQG1/entry","atlas":"/p/Q9NQG1"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}