{"uniprot":"Q9NTU4","gene":"CATSPERZ","name":"Cation channel sperm-associated protein subunit zeta","organism":"Homo sapiens (Human)","status":"dark","length":200,"sequence":"MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGRGSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN","function_summary":"An auxiliary subunit of the sperm flagellar machinery that assembles and stabilizes complexes required for calcium-dependent motility. It operates as a soluble scaffold that concentrates in the principal piece of the flagellum, where it organizes channel-associated assemblies and couples them to cytoskeletal architecture. By mediating multivalent protein interactions rather than catalysis, it supports motility, contributes to capacitation and spermatogenic maturation, and localizes from cytoplasmic pools to the flagellar core to maintain efficient waveform and signaling.","plain_language":"CATSPERZ has barely been studied. The model's best guess: An auxiliary subunit of the sperm flagellar machinery that assembles and stabilizes complexes required for calcium-dependent motility. It operates as a soluble scaffold that concentrates in the principal piece of the flagellum, where it organizes channel-associated assemblies and couples them to cytoskeletal architecture.","uniprot_summary":"Auxiliary component of a calcium channel complex, specifically involved in sperm motility.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0030317","label":"flagellated sperm motility"},{"id":"GO:0048240","label":"sperm capacitation"},{"id":"GO:0007140","label":"male meiotic nuclear division"},{"id":"GO:0007286","label":"spermatid development"}],"cellular_component":[{"id":"GO:0005737","label":"cytoplasm"},{"id":"GO:0097228","label":"sperm principal piece"}]},"interpro":[{"id":"IPR063833","name":"CATSPERZ, C-terminal helical domain","type":"domain","start":147,"end":199},{"id":"IPR039019","name":"Cation channel sperm-associated auxiliary subunit zeta","type":"family","start":1,"end":200}],"reasoning":"I begin with the InterPro architecture. The sequence is fully encompassed by IPR039019 (Cation channel sperm-associated auxiliary subunit zeta family, residues 1–200), marking the polypeptide as a sperm flagellar auxiliary component specialized for CatSper-dependent physiology. Within this family envelope sits IPR063833 (CATSPERZ, C-terminal helical domain, residues 147–199). A C-terminal helical module typically forms coiled-coil or rod-like scaffolds that mediate oligomerization and high-affinity protein–protein interactions rather than catalysis. The ordered layout—an N-to-C family-defining region capped by a C-terminal helical scaffold—creates a soluble adaptor optimized for multivalent assembly and targeting.\n\nThis architecture dictates molecular function as protein binding (GO:0005515). The absence of catalytic motifs and the presence of a dedicated helical assembly domain argue that the protein operates by binding and stabilizing larger complexes. In sperm flagella, such auxiliary subunits commonly chaperone and tune ion-channel assemblies and cytoskeletal attachments.\n\nFrom this binding-centric role, the biological processes follow. By stabilizing and positioning the CatSper apparatus and its associated cytoskeletal and membrane interfaces, the protein directly supports flagellated sperm motility (GO:0030317). Its assembly and targeting functions also underpin sperm capacitation (GO:0048240), a maturation state that primes motility and fertilization, and they contribute to earlier developmental contexts tied to male meiotic nuclear division (GO:0007140) and spermatid development (GO:0007286) through regulated assembly pathways that prepare the flagellum and surface specializations.\n\nCellular localization is a consequence of this assembly logic. The soluble, helical scaffold favors cytoplasmic pools (GO:0005737) that traffic to the flagellum. Its targeting determinants and binding partners concentrate it within the sperm principal piece (GO:0097228), the specialized segment housing the CatSper machinery and driving waveform generation. This matches the experimentally observed distribution: cytoplasmic pools that feed assembly into the flagellar core.\n\nMechanistically, the C-terminal helical domain provides a rigid assembly spine that nucleates complexes with membrane-channel constituents and cytoskeletal adaptors. I hypothesize that the protein binds the CatSper pore-forming subunits and auxiliary CatSperZ-family members to stabilize the channel lattice, while simultaneously engaging flagellar scaffolds and calcium-handling proteins. This dual engagement couples ion-channel regulation to axonemal mechanics, thereby tuning beat frequency and capacitation-linked signaling. Likely interaction partners include core CatSper channel subunits and their auxiliary cohort, calcium-binding and buffering proteins, and structural elements of the principal piece that together produce efficient motility.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9NTU4.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9NTU4"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9NTU4/entry","atlas":"/p/Q9NTU4"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}