{"uniprot":"Q9NU53","gene":"GINM1","name":"Glycoprotein integral membrane protein 1","organism":"Homo sapiens (Human)","status":"dark","length":330,"sequence":"MEGAPPGSLALRLLLFVALPASGWLTTGAPEPPPLSGAPQDGIRINVTTLKDDGDISKQQVVLNITYESGQVYVNDLPVNSGVTRISCQTLIVKNENLENLEEKEYFGIVSVRILVHEWPMTSGSSLQLIVIQEEVVEIDGKQVQQKDVTEIDILVKNRGVLRHSNYTLPLEESMLYSISRDSDILFTLPNLSKKESVSSLQTTSQYLIRNVETTVDEDVLPGKLPETPLRAEPPSSYKVMCQWMEKFRKDLCRFWSNVFPVFFQFLNIMVVGITGAAVVITILKVFFPVSEYKGILQLDKVDVIPVTAINLYPDGPEKRAENLEDKTCI","function_summary":"A single-pass membrane glycoprotein that assembles multiprotein complexes through two luminal domains to modulate transcriptional programs indirectly from the endoplasmic reticulum. By organizing binding platforms rather than catalyzing reactions, it likely tunes ER-associated signaling pathways that feed into RNA polymerase II, enabling both activation and repression of transcription. Its ER localization and modular architecture position it to scaffold complexes that influence gene expression without direct DNA binding.","plain_language":"GINM1 has barely been studied. The model's best guess: A single-pass membrane glycoprotein that assembles multiprotein complexes through two luminal domains to modulate transcriptional programs indirectly from the endoplasmic reticulum. By organizing binding platforms rather than catalyzing reactions, it likely tunes ER-associated signaling pathways that feed into RNA polymerase II, enabling both activation and repression of transcription.","uniprot_summary":"May be involved in transcription regulation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0045944","label":"positive regulation of transcription by RNA polymerase II"},{"id":"GO:0000122","label":"negative regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005783","label":"endoplasmic reticulum"}]},"interpro":[{"id":"IPR060605","name":"Glycoprotein integral membrane protein 1, N-terminal domain","type":"domain","start":44,"end":188},{"id":"IPR060606","name":"Glycoprotein integral membrane protein 1, C-terminal domain","type":"domain","start":238,"end":289},{"id":"IPR042319","name":"Glycoprotein integral membrane protein 1","type":"family","start":1,"end":327}],"reasoning":"I begin with the InterPro architecture. The polypeptide is covered end-to-end by IPR042319 (Glycoprotein integral membrane protein 1 family, residues 1–327), which defines a conserved single-pass membrane glycoprotein scaffold. Within this framework, the luminal/extracellular region is partitioned into IPR060605 (N-terminal domain, residues 44–188) and IPR060606 (C-terminal domain, residues 238–289). The ordered layout—an N-terminal luminal domain followed by a C-terminal luminal domain proximal to a single transmembrane segment—creates a bipartite ectodomain that is well suited for ligand or cofactor binding and for assembling macromolecular complexes. The absence of catalytic motifs and the presence of two structured luminal modules argue that the core activity is non-enzymatic complex assembly and modulation, which directly supports GO:0005515 protein binding as the molecular function.\n\nA single-pass membrane architecture with large luminal domains naturally localizes to the secretory pathway. The family signature and the modular arrangement favor insertion into the endoplasmic reticulum (ER) membrane, where folding, glycosylation, and complex assembly occur. This reasoning aligns with GO:0005783 endoplasmic reticulum and with a single-pass membrane topology. From this ER platform, the protein’s binding capacity can be harnessed to tune transcriptional outputs indirectly: by assembling or stabilizing signaling and trafficking complexes that feed into nuclear pathways.\n\nHow does membrane assembly propagate to transcription? The bipartite luminal domains can capture or present luminal cues and bind cytosolic partners via short cytosolic tails, thereby nucleating pathways that impinge on RNA polymerase II. Such assemblies can either enhance or repress transcriptional programs depending on context. This dual regulatory potential explains participation in both GO:0045944 positive regulation of transcription by RNA polymerase II and GO:0000122 negative regulation of transcription by RNA polymerase II. Mechanistically, the membrane scaffold can bias transcription through ER-to-nucleus signaling axes—retroviral Rev-responsive assemblies, ER stress sensors, or adaptor complexes that modulate transcription factor availability.\n\nThe cellular component is thus anchored in the ER, with the protein functioning as a single-pass organizer that influences downstream nuclear transcription via signaling relays. I hypothesize that the N-terminal domain (IPR060605, residues 44–188) nucleates luminal complex formation and glycan-dependent maturation, while the C-terminal domain (IPR060606, residues 238–289) provides a second binding surface that stabilizes cytosolic or membrane-proximal partners. This architecture causes multivalent protein binding that tunes transcriptional balance without direct DNA binding.\n\nFrom this model, likely interaction partners include ER-resident chaperones and assembly factors (e.g., calnexin/calreticulin cycles and COPII/COPI adaptors), retroviral Rev-Responsive Complex components that classically assemble at membranes, and transcriptional regulators that traffic through ER-associated signaling hubs. These associations would allow the protein to couple ER membrane organization to both positive and negative transcriptional regulation.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9NU53.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9NU53"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9NU53/entry","atlas":"/p/Q9NU53"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}