{"uniprot":"Q9NUC0","gene":"SERTAD4","name":"SERTA domain-containing protein 4","organism":"Homo sapiens (Human)","status":"dark","length":356,"sequence":"MTLVLSMNRFCEPIVSEGAAEIAGYQTLWEADSYGGPSPPGPAQAPLQGDRGAGPPLAGSHYRGISNPITTSKITYFKRKYVEEEDFHPPLSSCSHKTISIFEERAHILYMSLEKLKFIDDPEVYLRRSVLINNLMKRIHGEIIMQNNWCFPACSFNGTSAQEWFMAQDCPYRKRPRMAKEECEKFHACCFYQECGGHYLNLPLSVNANVGSASTAASSPSASSSSSSSSSSPPLPLPSCSRQVDFDVGSASIYKSDGQIPANEIFVTNVRSLGVQEKAKLNDEKANDDTNRDGGPLSHEPVGNDLAFECKGQFYDYFETGYNERNNVNESWKKSLRKKEASPPSNKLCCSKGSKI","function_summary":"A soluble human regulatory scaffold that uses a SERTA-centered interaction module to assemble transcriptional and signaling complexes. By organizing repressors and chromatin modifiers, it dampens transcription factor activity and suppresses osteoblast differentiation programs. In parallel, it enhances assembly and activity of upstream inflammatory signaling modules that drive NF-kappaB activation. The protein operates across the cytosol and nucleoplasm, shuttling between compartments to couple cytoplasmic signaling with nuclear gene control through multivalent protein binding.","plain_language":"SERTAD4 has barely been studied. The model's best guess: A soluble human regulatory scaffold that uses a SERTA-centered interaction module to assemble transcriptional and signaling complexes. By organizing repressors and chromatin modifiers, it dampens transcription factor activity and suppresses osteoblast differentiation programs.","uniprot_summary":"May be involved in transcriptional regulation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0045668","label":"negative regulation of osteoblast differentiation"},{"id":"GO:0043433","label":"negative regulation of DNA-binding transcription factor activity"},{"id":"GO:0043123","label":"positive regulation of I-kappaB kinase/NF-kappaB signaling"},{"id":"GO:0045892","label":"negative regulation of DNA-templated transcription"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR009263","name":"SERTA domain","type":"domain","start":101,"end":147},{"id":"IPR029708","name":"SERTA domain-containing protein 4","type":"family","start":1,"end":356}],"reasoning":"I begin with the InterPro architecture. The polypeptide carries IPR009263 (SERTA domain, residues 101–147) embedded within a longer family signature IPR029708 (SERTA domain-containing protein 4 family, residues 1–356). The SERTA module is a hallmark of transcriptional coregulators that lack intrinsic DNA-binding or enzymatic motifs but provide protein–protein interaction surfaces that assemble regulatory complexes. Its central placement (101–147) within a larger scaffold-like family region creates a bipartite platform: N- and C-terminal segments stabilize the fold and recruit partners, while the SERTA core nucleates higher-order assemblies. This architecture causes a primary molecular function of multivalent protein binding, aligning with GO:0005515 protein binding.\n\nFrom this binding-centric core, I infer regulatory outcomes in transcription and signaling. SERTA-containing scaffolds typically modulate transcription factor activity by assembling repressors and chromatin modifiers rather than binding DNA directly. Such assemblies explain negative control of transcriptional outputs, consistent with GO:0045892 negative regulation of DNA-templated transcription and GO:0043433 negative regulation of DNA-binding transcription factor activity. By dampening transcription factor activity and recruiting repressive machinery, the protein can attenuate osteoblast-promoting gene programs, supporting GO:0045668 negative regulation of osteoblast differentiation.\n\nThe same scaffold can couple transcriptional control to inflammatory signaling. Positive modulation of I-kappaB kinase/NF-kappaB signaling (GO:0043123) is parsimoniously explained if the SERTA platform stabilizes upstream IKK complexes or their adaptors, thereby enhancing NF-kappaB activation cascades. This dual regulatory capacity—repressing certain transcription factor pathways while potentiating NF-kappaB—arises naturally from a shared assembly logic: the SERTA domain concentrates signaling and chromatin regulators that bias pathway flux.\n\nCellular localization follows from function and architecture. The absence of transmembrane segments and the presence of a soluble interaction scaffold point to a cytosolic pool that assembles signaling complexes, matching GO:0005829 cytosol and the broader cytoplasmic designation. Transcriptional coregulation further requires nuclear access; shuttling into the nucleoplasm (GO:0005654 nucleoplasm) allows the complex to interface with chromatin and transcriptional machinery. Thus, the protein operates across cytosol and nucleoplasm, consistent with a soluble regulator that traffics between compartments.\n\nMechanistically, I hypothesize that the SERTA core recruits transcriptional repressors and chromatin modifiers to silence osteogenic gene modules while simultaneously stabilizing IKK–NF-kappaB assemblies. In the cytosol, it likely binds IKK complex components and adaptors to bias pathway activation; in the nucleus, it associates with transcription factors and corepressor complexes to restrain their activity. Candidate partners include NF-kappaB pathway constituents (IKK subunits and adaptors), osteogenic transcription factors (e.g., RUNX2 and SP7/Osterix), and corepressor systems such as HDAC-containing assemblies and NCoR/SMRT. This interaction web explains how a non-enzymatic SERTA scaffold can coordinate negative regulation of transcription and osteoblast differentiation with positive tuning of NF-kappaB signaling across cytosolic and nucleoplasmic compartments.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9NUC0.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9NUC0"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9NUC0/entry","atlas":"/p/Q9NUC0"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}