{"uniprot":"Q9NV79","gene":"PCMTD2","name":"Protein-L-isoaspartate O-methyltransferase domain-containing protein 2","organism":"Homo sapiens (Human)","status":"dark","length":361,"sequence":"MGGAVSAGEDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHGNIHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEYAKQKLDFFIRTSDSFDKFDFCEPSFVTGNCLEISPDCSQYDRVYCGAGVQKEHEEYMKNLLKVGGILVMPLEEKLTKITRTGPSAWETKKILAVSFAPLIQPCHSESGKSRLVQLPPVAVRSLQDLARIAIRGTIKKIIHQETVSKNGNGLKNTPRFKRRRVRRRRMETIVFLDKEVFASRISNPSDDNSCEDLEEERREEEEKTPPETKPDPPVNFLRQKVLSLPLPDPLKYYLLYYREK","function_summary":"A soluble human enzyme that uses S-adenosyl-L-methionine–dependent methyl transfer to recognize and repair isoaspartyl damage in proteins. By transiently methylating aberrant aspartyl linkages, it diverts damaged substrates between repair and proteasome-directed turnover, thereby coupling protein quality control to ubiquitination and SCF-mediated degradation pathways. Operating in both cytosol and nucleoplasm, it helps maintain proteome integrity and tunes growth signaling, including mTOR pathway regulation, through substrate triage and complex formation with degradation machinery.","plain_language":"PCMTD2 has barely been studied. The model's best guess: A soluble human enzyme that uses S-adenosyl-L-methionine–dependent methyl transfer to recognize and repair isoaspartyl damage in proteins. By transiently methylating aberrant aspartyl linkages, it diverts damaged substrates between repair and proteasome-directed turnover, thereby coupling protein quality control to ubiquitination and SCF-mediated degradation pathways.","uniprot_summary":"Initiates the repair of damaged proteins by catalyzing the formation of normal peptide bonds from isoaspartyl residues in proteins.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0036211","label":"protein modification process"},{"id":"GO:0030163","label":"protein catabolic process"},{"id":"GO:0032006","label":"regulation of TOR signaling"},{"id":"GO:0016567","label":"protein ubiquitination"},{"id":"GO:0031146","label":"SCF-dependent proteasomal ubiquitin-dependent protein catabolic process"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR029063","name":"S-adenosyl-L-methionine-dependent methyltransferase superfamily","type":"homologous_superfamily","start":6,"end":225},{"id":"IPR000682","name":"Protein-L-isoaspartate(D-aspartate) O-methyltransferase","type":"family","start":1,"end":221}],"reasoning":"I begin with the InterPro architecture. The sequence is dominated by IPR000682 (Protein-L-isoaspartate(D-aspartate) O-methyltransferase family) spanning residues 1–221, which defines a specialized enzyme class that recognizes aberrant beta-linked isoaspartate residues in proteins. This family signature is embedded within IPR029063 (S-adenosyl-L-methionine-dependent methyltransferase superfamily, residues 6–225), a broad Rossmann-like fold that binds S-adenosyl-L-methionine (SAM) and catalyzes O-methyl transfer. The ordered layout—an N-to-C continuous SAM-dependent methyltransferase core that is explicitly tailored to isoaspartyl substrates—causally establishes a methyltransferase that uses SAM to transiently methylate damaged aspartyl residues, thereby driving their conversion and turnover. The absence of transmembrane segments and the soluble SAM-dependent fold indicate a cytosolic/nucleoplasmic enzyme rather than a membrane component.\n\nFrom this architecture, the molecular function resolves into two facets. First, the catalytic core dictates methyltransfer chemistry that repairs aged or stress-exposed proteins by isoaspartyl repair. Second, the enzyme must form transient complexes with damaged substrates and with cellular pathways that handle downstream degradation; this necessitates multivalent protein binding, aligning with GO:0005515 protein binding as a basal capability that enables substrate capture and pathway coupling.\n\nThe catalytic repair of isoaspartate directly feeds into several biological processes. By methylating isoaspartyl residues, the enzyme initiates pathways that either restore native backbones or commit damaged proteins to turnover. This causal placement explains participation in GO:0036211 protein modification process and GO:0030163 protein catabolic process. The enzyme’s product—methylated isoaspartyl intermediates—readily routes into ubiquitin–proteasome systems, rationalizing involvement in GO:0016567 protein ubiquitination and GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process. Isoaspartyl damage accumulates under oxidative and nitrosative stress; coupling repair to proteostasis provides a mechanistic bridge to nutrient and growth signaling. This provides a route to influence GO:0032006 regulation of TOR signaling: by preserving or removing key signaling components, the enzyme modulates mTOR pathway flux in response to proteome damage.\n\nCellular localization follows from solubility and function. The SAM-dependent methyltransferase fold lacks secretion signals or membrane anchors, favoring a soluble intracellular distribution. Isoaspartyl damage is pervasive in both cytoplasmic and nuclear proteins; thus the enzyme operates in the cytoplasm and nucleoplasm, consistent with GO:0005829 cytosol and GO:0005654 nucleoplasm.\n\nMechanistically, the enzyme binds SAM and recognizes isoaspartyl topology in target proteins, transfers a methyl group to the hydroxyl-bearing oxygen, and thereby promotes succinimide formation and downstream repair or degradation. This chemistry positions the enzyme as a gatekeeper between damage sensing and proteasome engagement. I hypothesize that it transiently associates with SCF ubiquitin ligase assemblies and the 26S proteasome to hand off methylated, degradation-prone substrates. Likely partners include SKP1–CUL1–F-box modules for substrate commitment, E3 ligases that decorate repaired substrates, and mTOR pathway scaffolds whose stability and signaling output are tuned by isoaspartyl burden. Together, these interactions explain how a soluble SAM-dependent methyltransferase orchestrates protein quality control and growth signaling in the cytosol and nucleoplasm.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9NV79.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9NV79"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9NV79/entry","atlas":"/p/Q9NV79"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}