{"uniprot":"Q9NWQ9","gene":"C14orf119","name":"Uncharacterized protein C14orf119","organism":"Homo sapiens (Human)","status":"dark","length":140,"sequence":"MPLESSSSMPLSFPSLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANWSGPQRERFLEDLVAKAVPEKLQPLLDSLEQLSVSGADRPPSIFECQLHLWDQWFRGWAEQERNEFVRQLEFSEPDFVAKFYQAVAATAGKD","function_summary":"A soluble human adaptor that organizes receptor-proximal signaling assemblies to tune G protein-coupled receptor pathways and drive cytoskeleton-dependent behaviors. Operating primarily in the cytosol with transient mitochondrial association, it likely scaffolds multiprotein complexes that modulate signaling amplitude and timing, thereby influencing cell migration and invasion by coordinating pathway flux with local metabolic support.","plain_language":"C14orf119 has barely been studied. The model's best guess: A soluble human adaptor that organizes receptor-proximal signaling assemblies to tune G protein-coupled receptor pathways and drive cytoskeleton-dependent behaviors. Operating primarily in the cytosol with transient mitochondrial association, it likely scaffolds multiprotein complexes that modulate signaling amplitude and timing, thereby influencing cell migration and invasion by coordinating pathway flux with local metabolic support.","uniprot_summary":"May be involved in cell migration and invasion.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0008277","label":"regulation of G protein-coupled receptor signaling pathway"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005739","label":"mitochondrion"}]},"interpro":[{"id":"IPR028019","name":"Protein of unknown function DUF4508","type":"family","start":8,"end":138}],"reasoning":"I begin with the domain architecture. The sequence contains a single annotated region, IPR028019 (Protein of unknown function DUF4508 family) spanning residues 8–138. This compact, centrally placed DUF suggests a soluble, non-enzymatic module that mediates macromolecular interactions rather than catalysis. The absence of additional catalytic or transmembrane signatures implies a cytosolic adaptor/scaffold that organizes signaling assemblies. Such an adaptor architecture causally supports a primary molecular role in multivalent protein association, aligning with GO:0005515 protein binding.\n\nFrom this scaffold-like core, I infer how the protein influences signaling. The DUF4508-centered adaptor can nucleate complexes that tune heterotrimeric G protein pathways. By stabilizing or positioning receptor-proximal components, it can modulate the amplitude and timing of downstream cascades, which maps to GO:0008277 regulation of G protein-coupled receptor signaling pathway. The same adaptor logic explains how the protein contributes to cell migration and invasion: GPCR pathways intricately interface with cytoskeletal remodeling and motility circuits; a cytosolic scaffold that biases pathway flux will secondarily steer invasive behavior.\n\nCellular localization follows from the soluble adaptor architecture and the processes it regulates. A cytosolic distribution is expected for a non-membranous scaffold coordinating GPCR-proximal and cytoskeletal modules, consistent with GO:0005829 cytosol and the broader cytoplasmic designation. The additional presence in GO:0005739 mitochondrion is mechanistically coherent: GPCR signaling and motility are tightly coupled to mitochondrial positioning and metabolism. A cytosolic adaptor that transiently associates with mitochondria can tune local ATP supply and redox signaling at the leading edge, thereby influencing migration dynamics.\n\nPutting these elements together yields a mechanistic hypothesis. The DUF4508 module forms a platform that binds signaling and cytoskeletal proteins to regulate GPCR pathway throughput. In the cytosol, it likely assembles complexes with heterotrimeric G protein subunits and effectors; at mitochondria, it may coordinate metabolic support for motility. Through these assemblies, the protein adjusts receptor-proximal signaling thresholds and cytoskeletal outputs, thereby shaping cell migration and invasion.\n\nFrom this model, I anticipate interactions with GPCR pathway components and motility machinery. Likely partners include heterotrimeric G protein subunits (Gi/Go families), G protein-coupled receptor kinases and arrestins for receptor desensitization, small GTPases (Rac1, RhoA) and focal adhesion adaptors that couple signaling to actin remodeling, and mitochondrial surface proteins that mediate cytosol–mitochondrion crosstalk. These associations would collectively position the adaptor to regulate signaling flux and energy coupling required for invasive behavior.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9NWQ9.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9NWQ9"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9NWQ9/entry","atlas":"/p/Q9NWQ9"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}