{"uniprot":"Q9P086","gene":"MED11","name":"Mediator of RNA polymerase II transcription subunit 11","organism":"Homo sapiens (Human)","status":"dark","length":117,"sequence":"MATYSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLEN","function_summary":"A nuclear scaffold subunit of the human Mediator complex that stabilizes assemblies between gene-specific regulators and the basal transcription machinery. By furnishing multivalent binding surfaces, it helps recruit and organize initiation factors and RNA polymerase II at promoters, thereby enhancing the efficiency and fidelity of transcription initiation within the nuclear environment.","plain_language":"MED11 has barely been studied. The model's best guess: A nuclear scaffold subunit of the human Mediator complex that stabilizes assemblies between gene-specific regulators and the basal transcription machinery. By furnishing multivalent binding surfaces, it helps recruit and organize initiation factors and RNA polymerase II at promoters, thereby enhancing the efficiency and fidelity of transcription initiation within the nuclear environment.","uniprot_summary":"Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0060261","label":"positive regulation of transcription initiation by RNA polymerase II"}],"cellular_component":[{"id":"GO:0016592","label":"mediator complex"},{"id":"GO:0070847","label":"core mediator complex"}]},"interpro":[{"id":"IPR019404","name":"Mediator complex, subunit Med11","type":"family","start":1,"end":113}],"reasoning":"I begin with the InterPro architecture: IPR019404 (Mediator complex, subunit Med11 family) spans residues 1–113 and covers the entire polypeptide. A single, full-length family signature that defines a Mediator core subunit indicates a dedicated architectural role rather than enzymatic catalysis. Med11-family proteins form part of the core Mediator scaffold that organizes contacts between gene-specific regulators and the basal transcription machinery. This architecture enforces multivalent assembly and positioning of transcriptional modules, which causally produces broad protein-binding capacity rather than catalytic chemistry.\n\nFrom this scaffolded architecture, the molecular function resolves to GO:0005515 protein binding. The absence of catalytic motifs and the presence of a Mediator-core family signature dictate that the protein’s primary activity is to bind other proteins—Mediator subunits, transcription factors, and RNA polymerase II-associated factors—thereby stabilizing higher-order assemblies.\n\nSuch binding-driven assembly directly drives transcriptional initiation outcomes. By stabilizing the preinitiation complex and transmitting regulatory inputs to RNA polymerase II, this subunit promotes assembly and activity of the initiation machinery. This causal chain aligns with GO:0060261 positive regulation of transcription initiation by RNA polymerase II: the Med11-family scaffold increases the probability and efficiency of initiation events by coordinating factor recruitment and chromatin-proximal architecture.\n\nCellular localization follows from function and complex membership. As a core element of the Mediator apparatus, the protein resides in GO:0016592 mediator complex and specifically the GO:0070847 core mediator complex. These assemblies operate in the nuclear compartment where transcription is executed, supporting a nuclear localization consistent with the experimentally grounded placement of Mediator at promoters and enhancers.\n\nMechanistically, the Med11-family fold forms a structural node that couples gene-specific activators to the basal transcription apparatus. By binding neighboring Mediator subunits and transiently engaging transcription factors and RNA polymerase II, it biases the equilibrium toward preinitiation complex formation. I hypothesize that it nucleates interfaces with other core Mediator components and with initiation factors, enabling signal-responsive tuning of promoter-proximal assembly. Likely interaction partners include other core Mediator subunits and initiation machinery that together create a conduit from regulatory DNA-bound proteins to the polymerase platform.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9P086.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9P086"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9P086/entry","atlas":"/p/Q9P086"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}