{"uniprot":"Q9P1P4","gene":"TAAR3P","name":"Putative trace amine-associated receptor 3","organism":"Homo sapiens (Human)","status":"dark","length":343,"sequence":"MDLTYIPEDLSSCPKFVNKILSSHQPLFSCPGDNVFGYDWSHDYPLFGNLVIMVSISHFKQLHSPTNFLILSMATTDFLLGFVIMPYSIMRSVESCWYFGDGFCKFHTSFDMMLRLTSIFHLCSIAIDRFYAVCYPLHYTTKMTNSTIKQLLAFCWSVPALFSFGLVLSEADVSGMQSYKILVACFNFCALTFNKFWGTILFTTCFFTPGSIMVGIYGKIFIVSKQHARVISHVPENTKGAVKKHLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDYSTPILILDLLVWLRYFNSTCNPLIHGFFNPWFQKAFKYIVSGKIFSSHSETANLFPEAH","function_summary":"A human seven-transmembrane receptor at the cell surface that senses trace amine cues and transduces them into intracellular signals via heterotrimeric G proteins. Its rhodopsin-like architecture enables ligand-triggered conformational changes that activate G protein pathways, likely biasing cAMP production and downstream signaling. Positioned in the plasma membrane as a multi-pass protein, it integrates extracellular amine signals into intracellular responses through canonical GPCR mechanisms modulated by kinase- and arrestin-mediated feedback.","plain_language":"TAAR3P has barely been studied. The model's best guess: A human seven-transmembrane receptor at the cell surface that senses trace amine cues and transduces them into intracellular signals via heterotrimeric G proteins. Its rhodopsin-like architecture enables ligand-triggered conformational changes that activate G protein pathways, likely biasing cAMP production and downstream signaling.","uniprot_summary":"Orphan receptor.","go_terms":{"molecular_function":[{"id":"GO:0004930","label":"G protein-coupled receptor activity"}],"biological_process":[{"id":"GO:0007186","label":"G protein-coupled receptor signaling pathway"}],"cellular_component":[{"id":"GO:0005886","label":"plasma membrane"}]},"interpro":[{"id":"IPR017452","name":"GPCR, rhodopsin-like, 7TM","type":"domain","start":48,"end":309},{"id":"IPR000276","name":"G protein-coupled receptor, rhodopsin-like","type":"family","start":34,"end":324},{"id":"IPR009132","name":"Trace amine associated receptor family","type":"family","start":46,"end":323}],"reasoning":"I begin with the InterPro architecture. The core of the protein is IPR017452 (GPCR, rhodopsin-like, 7TM domain) spanning residues 48–309, a hallmark seven-transmembrane bundle that forms the ligand-binding pocket and the intracellular G protein–coupling interface. This domain sits within IPR000276 (G protein-coupled receptor, rhodopsin-like family) from residues 34–324, which defines the broader class A GPCR scaffold that transduces extracellular cues to intracellular effectors via heterotrimeric G proteins. Overlaying these, IPR009132 (Trace amine associated receptor family) from residues 46–323 specifies membership in the trace amine-associated receptor clade. The ordered layout—TAAR family signature embedded within a rhodopsin-like 7TM core—causally dictates a receptor that binds small biogenic amines and signals through G proteins.\n\nThis architecture enforces the molecular function formalized as GO:0004930 G protein-coupled receptor activity. The seven-helix bundle and conserved class A motifs create an allosteric switch: extracellular ligand binding stabilizes active-state conformations that expose intracellular surfaces for Gαβγ engagement. The TAAR family annotation narrows ligand chemistry toward trace amines; in humans, this clade often couples to Gs and elevates cAMP. Thus, the receptor’s activity initiates the biological process captured by GO:0007186 G protein-coupled receptor signaling pathway, propagating signals through second messengers such as cAMP and downstream kinase cascades.\n\nThe presence of a long hydrophobic 7TM region and absence of luminal targeting signals place the protein in the plasma membrane, consistent with GO:0005886 plasma membrane and the experimentally supported cell membrane localization. The multi-pass nature of the 7TM core explains its stable residency and signaling competence at the cell surface.\n\nMechanistically, the TAAR family identity suggests a receptor tuned to endogenous trace amines. In human cells, this often manifests as a cAMP-elevating module that can be modulated by accessory factors. I hypothesize that the receptor preferentially couples to Gs to raise cAMP, with basal activity tempered by intracellular phosphodiesterases and receptor phosphorylation. Likely interaction partners include heterotrimeric G proteins (GNAS for Gs, GNB/GNG subunits), GPCR kinases (GRK2/GRK6) and beta-arrestins (ARRB1/ARRB2) that govern desensitization and trafficking. Class A GPCR biogenesis and trafficking factors such as RTP1 and REEP family members may assist folding and surface delivery. Together, these interactions would tune sensitivity to trace amines and route signals through canonical GPCR pathways at the plasma membrane.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9P1P4.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9P1P4"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9P1P4/entry","atlas":"/p/Q9P1P4"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}