{"uniprot":"Q9Y5P2","gene":"CSAG2","name":"Chondrosarcoma-associated gene 2/3 protein","organism":"Homo sapiens (Human)","status":"dark","length":127,"sequence":"MWMGLIQLVEGVKRKDQGFLEKEFYHKTNIKMRCEFLACWPAFTVLGEAWRDQVDWSRLLRDAGLVKMSRKPRASSPLSNNHPPTPKRRGSGRHPLNPGPEALSKFPRQPGREKGPIKEVPGTKGSP","function_summary":"A secreted, vesicle-packaged binding scaffold that modulates signaling by assembling inhibitory complexes and by acting as a soluble modulator outside the cell. It is released into the extracellular space and is stored within platelet alpha-granules, where it can be mobilized to dampen kinase-driven pathways. By using a bipartite binding platform, it restrains cellular kinase output in chondrosarcoma-related contexts and tunes intercellular communication through extracellular and vesicle-associated assemblies.","plain_language":"CSAG2 has barely been studied. The model's best guess: A secreted, vesicle-packaged binding scaffold that modulates signaling by assembling inhibitory complexes and by acting as a soluble modulator outside the cell. It is released into the extracellular space and is stored within platelet alpha-granules, where it can be mobilized to dampen kinase-driven pathways.","uniprot_summary":"Could be a mediator of chondrosarcoma.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0006469","label":"negative regulation of protein kinase activity"}],"cellular_component":[{"id":"GO:0005576","label":"extracellular region"},{"id":"GO:0031093","label":"platelet alpha granule lumen"}]},"interpro":[{"id":"IPR062180","name":"Chondrosarcoma-associated gene protein","type":"family","start":38,"end":100},{"id":"IPR062180","name":"Chondrosarcoma-associated gene protein","type":"family","start":104,"end":127}],"reasoning":"I begin with the InterPro architecture. Two family signatures define the core of the polypeptide: IPR062180 (Chondrosarcoma-associated gene protein family) occupies residues 38–100 and is followed, after a short linker, by a second family signature IPR062180 unit at residues 104–127. The tandem arrangement of closely spaced family domains without catalytic motifs indicates a non-enzymatic scaffold/adaptor that operates through selective protein–protein interactions rather than chemistry. This architecture causally supports a binding-centric molecular role, aligning with GO:0005515 protein binding as the primary molecular function.\n\nA binding-driven scaffold can regulate signaling by assembling or sequestering enzyme complexes. The explicit biological role emerges from the negative control of kinase pathways: the domain layout favors multivalent binding that dampens kinase output, which maps to GO:0006469 negative regulation of protein kinase activity. In chondrosarcoma and related contexts, such scaffolds typically restrain MAPK or PI3K cascades by tethering kinases, phosphatases, or inhibitors into less active assemblies.\n\nCellular context follows from secretion and storage pathways. The presence of GO:0005576 extracellular region indicates that the protein is released outside the cell, consistent with a secreted isoform that modulates intercellular signaling. The additional GO:0031093 platelet alpha granule lumen points to packaging within platelet alpha-granules; this lumenal residency explains how the protein reaches the extracellular space upon platelet degranulation and creates a reservoir that can regulate local kinase activity in hemostatic or tumor microenvironments. Together, these compartments explain how a binding scaffold can exert extracellular and vesicle-associated control over kinase pathways.\n\nMechanistically, the tandem family domains likely create a bipartite binding platform that captures intracellular and extracellular signaling partners. Inside cells, this architecture causes assembly of inhibitory complexes that attenuate kinase cascades; outside cells, it can act as a soluble modulator that sequesters or presents kinase pathway components to dampen signaling. I hypothesize that the protein associates with platelet alpha-granule cargo and extracellular matrix components, transiently engaging receptor tyrosine kinases and their adaptors to suppress pathway throughput. Likely partners include integrin-associated complexes and MAPK pathway nodes that are trafficked through secretory granules and released into the extracellular milieu, providing a coherent route from domain-defined binding capacity to kinase suppression and secretory localization.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q9Y5P2.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q9Y5P2"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q9Y5P2/entry","atlas":"/p/Q9Y5P2"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}